def print_alignment_matrix(alignment_matrix, seq_x, seq_y): """ Helper function that prints out the alignment_matrix """ row_names = "0" + seq_x print "Alignment matrix where columns are: 0" + seq_y for index in range(len(seq_x)+1): print "For row", row_names[index], "=====>", alignment_matrix[index] ##################################### # Code for answering question 1 of the application # Read the HumanEyelessProtein and print the result human_protein = rfs.read_protein(HUMAN_EYELESS_URL) print "Human protein:" print human_protein print "Length human protein =", len(human_protein) print # Read the FruitflyEyelessProtein and print the result fruitfly_protein = rfs.read_protein(FRUITFLY_EYELESS_URL) print "Fruitfly protein:" print fruitfly_protein print "Length fruitfly protein =", len(fruitfly_protein) print # Read the PAM50 scoring matrix and print the result scoring_matrix = rfs.read_scoring_matrix(PAM50_URL) #print_scoring_matrix(scoring_matrix)
WORD_LIST_URL = "http://storage.googleapis.com/codeskulptor-assets/assets_scrabble_words3.txt" # Resulting local alignments from question 1 HUMAN_LOCAL = "HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEK-QQ" FRUITFLY_LOCAL = "HSGVNQLGGVFVGGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATAEVVSKISQYKRECPSIFAWEIRDRLLQENVCTNDNIPSVSSINRVLRNLAAQKEQQ" # Set timeout for CodeSkulptor (only if this code is run in Code Skulptor) # import codeskulptor # codeskulptor.set_timeout(20) ##################################### # Code for answering question 2 of the application # Read the ConsensusPAXDomain and print the result consensus_pax = rfs.read_protein(CONSENSUS_PAX_URL) print "Consensus PAX domain protein:" print consensus_pax print "Length consensus PAX domain protein =", len(consensus_pax) print # Read the PAM50 scoring matrix and print the result scoring_matrix = rfs.read_scoring_matrix(PAM50_URL) # Computations for the human protein sequence # . remove all '-' from the sequence lst_of_strings = HUMAN_LOCAL.split("-") human_local = "" for substring in lst_of_strings: human_local += substring # . compute the alignment between this sequence and the ConsensusPAXDomain sequence