def balanceplot(balances, tree, layout=None, mode='c'): """ Plots balances on tree. Parameters ---------- balances : np.array A vector of internal nodes and their associated real-valued balances. The order of the balances will be assumed to be in level order. tree : skbio.TreeNode A strictly bifurcating tree defining a hierarchical relationship between all of the features within `table`. layout : function, optional A layout for formatting the tree visualization. Must take a `ete.tree` as a parameter. mode : str Type of display to show the tree. ('c': circular, 'r': rectangular). Note ---- The `tree` is assumed to strictly bifurcating and whose tips match `balances. See Also -------- TreeNode.levelorder """ # The names aren't preserved - let's pray that the topology is consistent. ete_tree = Tree(str(tree)) # Some random features in all nodes i = 0 for n in ete_tree.traverse(): if not n.is_leaf(): n.add_features(weight=balances[-i]) i += 1 # Create an empty TreeStyle ts = TreeStyle() # Set our custom layout function if layout is None: ts.layout_fn = default_layout else: ts.layout_fn = layout # Draw a tree ts.mode = mode # We will add node names manually ts.show_leaf_name = False # Show branch data ts.show_branch_length = True ts.show_branch_support = True return ete_tree, ts
def get_example_tree(): # Set dashed blue lines in all leaves nst1 = NodeStyle() nst1["bgcolor"] = "LightSteelBlue" nst2 = NodeStyle() nst2["bgcolor"] = "Moccasin" nst3 = NodeStyle() nst3["bgcolor"] = "DarkSeaGreen" nst4 = NodeStyle() nst4["bgcolor"] = "Khaki" t = Tree("( 🌲,( 🥑,(( 🌷, ( 🌴, ( 🍌, ( 🍍, ( 🌽, ( 🎋, 🌾 )))))),(( 🍇, ((( 🥜, ☘️), ((( 🌹, 🍓 ), (( 🍎, 🍐 ), ( 🍑, (🌸, 🍒) ))), ( 🌰, ( 🎃, ( 🍉, ( 🥒, 🍈)))))), (( 🌺, 🥦 ), (( 🍊, 🍋 ), ( 🍁, 🥭))))),( 🌵, ( 🥝, (( 🍠, ( 🌶️, (🍆, ( 🥔, 🍅)))), ( 🥕,( 🥬, ( 🌻, 🌼)))))))));") for n in t.traverse(): n.dist = 0 n1 = t.get_common_ancestor("a1", "a2", "a3") n1.set_style(nst1) n2 = t.get_common_ancestor("b1", "b2", "b3", "b4") n2.set_style(nst2) n3 = t.get_common_ancestor("c1", "c2", "c3") n3.set_style(nst3) n4 = t.get_common_ancestor("b3", "b4") n4.set_style(nst4) ts = TreeStyle() ts.layout_fn = layout ts.show_leaf_name = False ts.mode = "c" ts.root_opening_factor = 1 return t, ts
def get_example_tree(): # Set dashed blue lines in all leaves nst1 = NodeStyle() nst1["bgcolor"] = "LightSteelBlue" nst2 = NodeStyle() nst2["bgcolor"] = "Moccasin" nst3 = NodeStyle() nst3["bgcolor"] = "DarkSeaGreen" nst4 = NodeStyle() nst4["bgcolor"] = "Khaki" t = Tree("((((a1,a2),a3), ((b1,b2),(b3,b4))), ((c1,c2),c3));") for n in t.traverse(): n.dist = 0 n1 = t.get_common_ancestor("a1", "a2", "a3") n1.set_style(nst1) n2 = t.get_common_ancestor("b1", "b2", "b3", "b4") n2.set_style(nst2) n3 = t.get_common_ancestor("c1", "c2", "c3") n3.set_style(nst3) n4 = t.get_common_ancestor("b3", "b4") n4.set_style(nst4) ts = TreeStyle() ts.layout_fn = layout ts.show_leaf_name = False ts.mode = "c" ts.root_opening_factor = 1 return t, ts
def custom_treestyle(): ts = TreeStyle() ts.layout_fn = custom_layout ts.show_leaf_name = False ts.branch_vertical_margin = 0 ts.min_leaf_separation = 0 return ts
def generate_type_tree_figure(output_file): """ Generate type_tree.png image. It needs ETE dependencies installed cf http://etetoolkit.org/new_download/ or use anaconda :param output_file: str """ try: from ete3 import faces, TextFace, TreeStyle except ImportError as e: logger.warning( 'ImportError : %s Generation of type_tree figure need ETE dependencies to ' 'be installed Use from anaconda, or look at installation procedure on ' 'http://etetoolkit.org/new_download/', e) return # Define custom tree style ts = TreeStyle() ts.show_leaf_name = False ts.show_scale = False ts.orientation = 1 ts.branch_vertical_margin = 20 def my_layout(node): F = TextFace(node.name, fsize=16, ftype='Courier', bold=True) faces.add_face_to_node(F, node, column=10, position="branch-right") ts.layout_fn = my_layout TYPES_STRING_TREE.render(output_file, tree_style=ts)
def createImg(filename, thres=0, samples=1): count = parseLineage(filename) suffix, matrix, taxo = getSuffixandMatrixandNewick(count,thres,samples) newick = convert(taxo,suffix) newick += ';' t = Tree(newick, format=1) ct = ClusterTree(t.write(), text_array=matrix) addColors(ct) # nodes are linked to the array table array = ct.arraytable # Calculates some stats on the matrix. Needed to establish the color gradients. matrix_dist = [i for r in xrange(len(array.matrix))for i in array.matrix[r] if np.isfinite(i)] matrix_max = np.max(matrix_dist) matrix_min = np.min(matrix_dist) matrix_avg = (matrix_max+matrix_min)/2 # Creates a profile face that will represent node's profile as a heatmap profileFace = ProfileFace(matrix_max, matrix_min, matrix_avg, 200, 14, "heatmap",colorscheme=3) # Creates my own layout function that uses previous faces def mylayout(node): # If node is a leaf if node.is_leaf(): # And a line profile add_face_to_node(profileFace, node, 0, aligned=True) node.img_style["size"]=2 # Use my layout to visualize the tree ts = TreeStyle() ts.layout_fn = mylayout # ct.show(tree_style=ts) filedir = '/'.join(filename.split('/')[:-1]) # t.write(format=9, outfile="output/newick/"+param+".nw") ct.render(filedir+'/phylo.png',tree_style=ts)
def get_example_tree(): # Random tree t = Tree() t.populate(20, random_branches=True) # Some random features in all nodes for n in t.traverse(): n.add_features(weight=random.randint(0, 50)) # Create an empty TreeStyle ts = TreeStyle() # Set our custom layout function ts.layout_fn = layout # Draw a tree ts.mode = "c" # We will add node names manually ts.show_leaf_name = False # Show branch data ts.show_branch_length = True ts.show_branch_support = True return t, ts
def buble_tree(): built = False while not built: try: # Random tree t = ncbi.get_topology(idtaxa, intermediate_nodes=True) # Some random features in all nodes for node,weigh in zip(t,weighs): node.add_features(weight=weigh) # Create an empty TreeStyle ts = TreeStyle() # Set our custom layout function ts.layout_fn = layout # Draw a tree ts.mode = "c" # We will add node names manually ts.show_leaf_name = True # Show branch data ts.show_branch_length = True ts.show_branch_support = True return t, ts built = True except KeyError as e: taxid_not_found = int(e.args[0]) idtaxa.remove(taxid_not_found) print("the following IDs were not found in NCBI taxonomy database:" + str(taxid_not_found)) pass
def get_example_tree(): # Set dashed blue lines in all leaves nst1 = NodeStyle() nst1["bgcolor"] = "LightSteelBlue" nst2 = NodeStyle() nst2["bgcolor"] = "Moccasin" nst3 = NodeStyle() nst3["bgcolor"] = "DarkSeaGreen" nst4 = NodeStyle() nst4["bgcolor"] = "Khaki" t = Tree("((((a1,a2),a3), ((b1,b2),(b3,b4))), ((c1,c2),c3));") for n in t.traverse(): n.dist = 0 n1 = t.get_common_ancestor("a1", "a2", "a3") n1.set_style(nst1) n2 = t.get_common_ancestor("b1", "b2", "b3", "b4") n2.set_style(nst2) n3 = t.get_common_ancestor("c1", "c2", "c3") n3.set_style(nst3) n4 = t.get_common_ancestor("b3", "b4") n4.set_style(nst4) ts = TreeStyle() ts.layout_fn = layout ts.show_leaf_name = False ts.mode = "c" ts.root_opening_factor = 1 return t, ts
def get_example_tree(): # Random tree t = Tree(tree) t.populate(20, random_branches=True) # Some random features in all nodes for n in t.traverse(): n.add_features(weight=random.randint(0, 50)) # Create an empty TreeStyle ts = TreeStyle() # Set our custom layout function ts.layout_fn = layout # Draw a tree ts.mode = "c" # We will add node names manually ts.show_leaf_name = False # Show branch data ts.show_branch_length = True ts.show_branch_support = True return t, ts
def ete_draw(self, fname=None): """ Draws the tree and saves it to a file. If `fname` is None, show the tree instead of saving it. Args: fname: filename to save to (default=None) """ if Cfg.USE_ETE3: def layout(node): faces.add_face_to_node(AttrFace("name"), node, column=0, position="branch-right") ts = TreeStyle() ts.show_leaf_name = False ts.layout_fn = layout ts.rotation = 90 tree = EteTree(self.ete_str(), format=8) if fname: tree.render(fname, tree_style=ts) else: tree.show(tree_style=ts) else: # TODO maybe throw an error? pass
def get_example_tree(tree, color_dict=None, annot_dict=None, col=None): used_colours = set() for n in tree.traverse(): if n.is_leaf(): if n.name in annot_dict: n.img_style["bgcolor"] = color_dict[annot_dict[n.name]] used_colours.add(annot_dict[n.name]) ts = TreeStyle() ts.layout_fn = layout ts.show_leaf_name = False ts.mode = "c" # ts.arc_start = -180 # 0 degrees = 3 o'clock # ts.arc_span = 180 # ts.root_opening_factor = 1 # print (used_colours) for k,v in color_dict.items(): # Check that the specific colour was actually present in the tree we're annotating if k in used_colours: ts.legend.add_face(CircleFace(100, v), column=0) ts.legend.add_face(TextFace(k, fsize=50), column=1) # Add title ts.title.add_face(TextFace("Colouring tips on " + col, fsize=100), column=0) return tree, ts
def draw_raw_tree(filename: str) -> None: """Draws a raw tree from ete3 representation stored in a file Parameters ---------- filename : str a name of the file Returns ------- None """ ts = TreeStyle() ts.show_leaf_name = False ts.layout_fn = layout_raw ts.rotation = 90 ts.branch_vertical_margin = 10 ts.show_scale = False ts.scale = 50 ts.title.add_face(TextFace(" ", fsize=20), column=0) ete3_desc = read_ete3_from_file(filename) tree = Tree(ete3_desc, format=1) # tree.show(tree_style=ts) return tree.render("%%inline",tree_style=ts)
def ete_draw(self, fname=None): """ Draws the tree and saves it to a file. If `fname` is None, show the tree instead of saving it. Args: fname: filename to save to (default=None) """ if Cfg.USE_ETE3: def layout(node): faces.add_face_to_node(AttrFace("name"), node, column=0, position="branch-right") ts = TreeStyle() ts.show_leaf_name = False ts.layout_fn = layout ts.rotation = 90 tree = EteTree(self.ete_str(), format=8) if fname: tree.render(fname, tree_style=ts) else: tree.show(tree_style=ts) else: # TODO maybe throw an error? pass
def make_tree(t): ts = TreeStyle() ## make the tree in to a cladogram most_distant_leaf, tree_length = t.get_farthest_leaf() current_dist = 0 for postorder, node in t.iter_prepostorder(): if postorder: current_dist -= node.dist else: if node.is_leaf(): node.dist += tree_length - (current_dist + node.dist) elif node.up: # node is internal current_dist += node.dist ## Rotate and color the lables def rotation_layout(node): if node.is_leaf(): if node.name == 'X': F = TextFace(node.name, tight_text=True, fgcolor='Blue') F.rotation = 90 add_face_to_node(F, node, column=0, position="branch-right") elif node.name == 'Y': F = TextFace(node.name, tight_text=True, fgcolor='Red') F.rotation = 90 add_face_to_node(F, node, column=0, position="branch-right") elif node.name == 'A': F = TextFace("") add_face_to_node(F, node, column=0, position="branch-right") else: F = TextFace(node.name, tight_text=True, fgcolor='Green') F.rotation = 90 add_face_to_node(F, node, column=0, position="branch-right") ## Format the tree image nstyle = NodeStyle() nstyle["hz_line_type"] = 0 nstyle["vt_line_color"] = "#ffffff" nstyle["hz_line_color"] = "#ffffff" nstyle["vt_line_width"] = 4 nstyle["hz_line_width"] = 4 nstyle["size"] = 0 for n in t.traverse(): n.set_style(nstyle) ## Set background t.img_style["bgcolor"] = "#2e3440" ## Tree 'shape' ts.min_leaf_separation = 20 ts.show_leaf_name = False ts.layout_fn = rotation_layout ts.rotation = -90 ts.show_scale = False #t.show(tree_style=ts) t.render(f"{t.name}.svg", tree_style=ts, dpi=900)
def show_and_render_tree(tree, output_file_name, mut_order): # The following makes it show internal nodes def my_layout(node): if hasattr(node, 'has_face'): return if node.is_leaf(): # If terminal node, draws its name name_face = AttrFace("name", fsize=12) node.add_face(name_face, column=0, position="branch-right") else: # If internal node, draws label with smaller font size if node.name == 'root': label = 'root' else: label = str(mut_order[int(node.name)]) name_face = TextFace(label, fsize=10) node.add_face(name_face, column=0, position="branch-top") node.add_feature('has_face', True) # Adds the name face to the image at the preferred position #faces.add_face_to_node(name_face, node, column=0, position="branch-top") ts = TreeStyle() # Do not add leaf names automatically ts.show_leaf_name = False # Use my custom layout ts.layout_fn = my_layout tree.show(tree_style=ts) tree.render(output_file_name, tree_style=ts, dpi=180)
def get_example_tree(): # Random tree t = Tree() t = Tree( "(((yessefk),(ad, tuɣal),((teqbaylit),(d,(tutlayt,tunṣibt)))),(((win,yebɣan), (taqbaylit)),(((ad,yissin, (tira,-s))))),(((win,yebɣan), (taqbaylit)),(((yugar) , (ucerrig)), (tafawet))));" ) # Some random features in all nodes for n in t.traverse(): n.add_features(weight=random.randint(0, 50)) # Create an empty TreeStyle ts = TreeStyle() # Set our custom layout function ts.layout_fn = layout # Draw a tree ts.mode = "c" # We will add node names manually ts.show_leaf_name = False # Show branch data ts.show_branch_length = True ts.show_branch_support = True return t, ts
def compute_minimum_spanning_tree(file_name, artists, distance_matrix, authors, styles, list_period_color): dst_list = [] max = len(distance_matrix[-1]) for line in distance_matrix: remain = max - len(line) dst_list.append(line + [0.0] * remain) G = np.array(dst_list) Tcsr = minimum_spanning_tree(G) G = nx.Graph(Tcsr) elst = bfs_edge_lst(G, 1) tree = tree_from_edge_lst(elst) newick_minimum_spanning_tree = tree_to_newick(tree) + ';' t = Tree(newick_minimum_spanning_tree) vl = [] for node in t.traverse("postorder"): if node.is_leaf(): name = artists[int(node.name)] node.name = name else: name = artists[int(node.support)] node.name = name vl.append(node.name) ts = TreeStyle() ts, t = set_default_TreeStyle(t) def my_layout(node): F = TextFace("\t" + node.name, tight_text=True, fstyle="bold", fsize=40, fgcolor="black") F.rotation = 90 add_face_to_node(F, node, column=0, position="branch-bottom") ts.layout_fn = my_layout list_of_nodes = {} for author in authors: for node in t.traverse("postorder"): if (node.name == author): new_dic = get_sister_common_styles(node, artists, styles) list_of_nodes.update(new_dic) prevalent_dict = most_prevalent(list_of_nodes) for author in authors: for node in t.traverse("postorder"): if (node.name == author): attribute_legend(node, authors, styles) add_painting(node, im, basename) savename_period = "../plots/" + file_name + "Kruskal_minimum_spanning_tree.pdf" t.render(savename_period, tree_style=ts)
def get_example_tree(): t = Tree() ts = TreeStyle() ts.layout_fn = layout ts.mode = "r" ts.show_leaf_name = False t.populate(10) return t, ts
def custom_treestyle(): #Add treestyle ts = TreeStyle() #use custom layout fuction ts.layout_fn = custom_layout #don't show leaf names (leaf names can be customized in custom layout) ts.show_leaf_name = False return ts
def get_example_tree(): t = Tree() ts = TreeStyle() ts.layout_fn = layout ts.mode = "r" ts.show_leaf_name = False t.populate(10) return t, ts
def get_tree_style(self): ts = TreeStyle() ts.layout_fn = self.custom_layout ts.show_leaf_name = False ts.draw_guiding_lines = True #ts.guiding_lines_type = 1 self._treestyle = ts return ts
def export_tree(tree, filename, insignif_color, signif_color, i_group, width): ''' exports the given tree to the given filename ''' ts = TreeStyle() ts.show_leaf_name = False ts.show_scale = False ts.layout_fn = generate_layout(insignif_color, signif_color, i_group) tree.render(filename, w=width, tree_style=ts)
def get_example_tree(): t = Tree() ts = TreeStyle() ts.layout_fn = layout ts.mode = "c" ts.show_leaf_name = True ts.min_leaf_separation = 15 t.populate(100) return t, ts
def get_example_tree(): t = Tree() t.populate(10) ts = TreeStyle() ts.rotation = 45 ts.show_leaf_name = False ts.layout_fn = rotation_layout return t, ts
def get_example_tree(): t = Tree() t.populate(8, reuse_names=False) ts = TreeStyle() ts.layout_fn = master_ly ts.title.add_face(faces.TextFace("Drawing your own Qt Faces", fsize=15), 0) return t, ts
def create_tree_style(): ts = TreeStyle() ts.title.add_face(TextFace("Randomly pruned data", fsize=20), column=0) ts.layout_fn = remove_blue_dots ts.mode = "c" ts.show_leaf_name = True ts.show_branch_length = True ts.show_branch_support = True return ts
def get_example_tree(): t = Tree() ts = TreeStyle() ts.layout_fn = layout ts.mode = "c" ts.show_leaf_name = True ts.min_leaf_separation = 15 t.populate(100) return t, ts
def get_example_tree(): t = Tree() t.populate(8, reuse_names=False) ts = TreeStyle() ts.layout_fn = master_ly ts.title.add_face(faces.TextFace("Drawing your own Qt Faces", fsize=15), 0) return t, ts
def plot_tree(tree, leafname2data = None , show_support = False, figname = None, outfname_tree = None): def layout(node): nst_internal = NodeStyle() nst_internal['size'] = 1 nst_internal['fgcolor'] = 'black' nst_internal["vt_line_color"] = "black" nst_internal["hz_line_color"] = "black" nst_internal["vt_line_width"] = 1 nst_internal["hz_line_width"] = 1 nst_internal["vt_line_type"] = 0 #0 solid, 1 dashed, 2 dotted nst_internal["hz_line_type"] = 0 node.set_style(nst_internal) if leafname2data != None and node.is_leaf(): if not node.name[0] == '_': print(node.name) nst = NodeStyle() node_data = leafname2data[node.name] node_name = node.name node_shape = None node_color = None if len(node_data) >= 3: node_name = node_data[0] node_shape = node_data[1] node_color = '#'+node_data[2].lower() else: node_shape = node_data[0] node_color = '#'+node_data[1].lower() nst['size'] = 15 nst['shape'] = node_shape nst['fgcolor'] = node_color node.set_style(nst) #node.add_face(TextFace(node_name, ftype='Verdana', fsize=12), column = 0, position = "aligned") ts = TreeStyle() ts.layout_fn = layout ts.show_leaf_name = False if show_support: ts.show_branch_support = True ts.branch_vertical_margin = 10 if outfname_tree != None: tree.write(outfile = outfname_tree) if figname != None: tree.render(figname, layout=layout, w=None, h=None, tree_style=ts, units='px', dpi=300) else: tree.show(tree_style=ts)
def get_example_tree(): with open("avian_tree", "r") as infile: data = infile.read() t = Tree(data) ts = TreeStyle() ts.layout_fn = master_ly ts.title.add_face(faces.TextFace("Drawing your own Qt Faces", fsize=15), 0) return t, ts
def get_tree_style(): ts = TreeStyle() ts.show_leaf_name = False # True ts.layout_fn = layout ts.rotation = 90 ts.branch_vertical_margin = 10 ts.show_scale = False # ts.mode = "c" ts.scale = 50 ts.title.add_face(TextFace(" ", fsize=20), column=0) # for n in t.traverse(): # nstyle = NodeStyle() # nstyle["fgcolor"] = "red" # nstyle["size"] = 15 # n.set_style(nstyle) # ts.show_leaf_name = True ts.legend.add_face(TextFace(" "), column=0) ts.legend.add_face(TextFace(" "), column=1) ts.legend.add_face(RectFace(20, 20, NO_SUPPORT_COLOR, NO_SUPPORT_COLOR), column=0) ts.legend.add_face(TextFace(" Topic with no support (u(t)=0)"), column=1) ts.legend.add_face(TextFace(" "), column=0) ts.legend.add_face(TextFace(" "), column=1) ts.legend.add_face(RectFace(20, 20, "#90ee90", "#90ee90"), column=0) ts.legend.add_face(TextFace(" Topic with minor support 0<u(t)<=0.4"), column=1) ts.legend.add_face(TextFace(" "), column=0) ts.legend.add_face(TextFace(" "), column=1) ts.legend.add_face(RectFace(20, 20, "green", "green"), column=0) ts.legend.add_face( TextFace(u" Topic with medium support 0.4<u(t)<=0.6 "), column=1) ts.legend.add_face(TextFace(" "), column=0) ts.legend.add_face(TextFace(" "), column=1) ts.legend.add_face(RectFace(20, 20, "#004000", "#004000"), column=0) ts.legend.add_face(TextFace(" Topic with high support u(t)>0.6"), column=1) ts.legend.add_face(TextFace(" "), column=0) ts.legend.add_face(TextFace(" "), column=1) ts.legend.add_face(CircleFace(10, "red"), column=0) ts.legend.add_face(TextFace(" Gap"), column=1) ts.legend.add_face(TextFace(" "), column=0) ts.legend.add_face(TextFace(" "), column=1) ts.legend.add_face(RectFace(40, 40, "#004000", "#004000"), column=0) # green # ts.legend.add_face(CircleFace(15, "green"), column=1) ts.legend.add_face(TextFace(" Head subject or offshoot"), column=1) ts.legend_position = 4 # ts.title.add_face(TextFace(" ", fsize=20), column=0) return ts
def set_tree_style_extended(): ts = TreeStyle() # for i in range(16): # ts.legend.add_face(CircleFace(10, color_dictionary["N{0}".format(i)]), column=0) ts.show_leaf_name = False ts.show_branch_length = False ts.show_branch_support = False ts.layout_fn = my_layout_extended return ts
def show(self): """ Allows user to quickly view LinkTree """ style = TreeStyle() style.show_leaf_name = False def my_layout(node): node_style = TextFace(node.name, tight_text=True) add_face_to_node(node_style, node, column=0, position='branch-bottom') style.layout_fn = my_layout self._tree.show(tree_style=style)
def get_example_tree(): t = Tree() t.populate(8) # Node style handling is no longer limited to layout functions. You # can now create fixed node styles and use them many times, save them # or even add them to nodes before drawing (this allows to save and # reproduce an tree image design) # Set bold red branch to the root node style = NodeStyle() style["fgcolor"] = "#0f0f0f" style["size"] = 0 style["vt_line_color"] = "#ff0000" style["hz_line_color"] = "#ff0000" style["vt_line_width"] = 8 style["hz_line_width"] = 8 style["vt_line_type"] = 0 # 0 solid, 1 dashed, 2 dotted style["hz_line_type"] = 0 t.set_style(style) #Set dotted red lines to the first two branches style1 = NodeStyle() style1["fgcolor"] = "#0f0f0f" style1["size"] = 0 style1["vt_line_color"] = "#ff0000" style1["hz_line_color"] = "#ff0000" style1["vt_line_width"] = 2 style1["hz_line_width"] = 2 style1["vt_line_type"] = 2 # 0 solid, 1 dashed, 2 dotted style1["hz_line_type"] = 2 t.children[0].img_style = style1 t.children[1].img_style = style1 # Set dashed blue lines in all leaves style2 = NodeStyle() style2["fgcolor"] = "#000000" style2["shape"] = "circle" style2["vt_line_color"] = "#0000aa" style2["hz_line_color"] = "#0000aa" style2["vt_line_width"] = 2 style2["hz_line_width"] = 2 style2["vt_line_type"] = 1 # 0 solid, 1 dashed, 2 dotted style2["hz_line_type"] = 1 for l in t.iter_leaves(): l.img_style = style2 ts = TreeStyle() ts.layout_fn = layout ts.show_leaf_name = False return t, ts
def get_example_tree(): t = Tree() t.populate(8) # Node style handling is no longer limited to layout functions. You # can now create fixed node styles and use them many times, save them # or even add them to nodes before drawing (this allows to save and # reproduce an tree image design) # Set bold red branch to the root node style = NodeStyle() style["fgcolor"] = "#0f0f0f" style["size"] = 0 style["vt_line_color"] = "#ff0000" style["hz_line_color"] = "#ff0000" style["vt_line_width"] = 8 style["hz_line_width"] = 8 style["vt_line_type"] = 0 # 0 solid, 1 dashed, 2 dotted style["hz_line_type"] = 0 t.set_style(style) #Set dotted red lines to the first two branches style1 = NodeStyle() style1["fgcolor"] = "#0f0f0f" style1["size"] = 0 style1["vt_line_color"] = "#ff0000" style1["hz_line_color"] = "#ff0000" style1["vt_line_width"] = 2 style1["hz_line_width"] = 2 style1["vt_line_type"] = 2 # 0 solid, 1 dashed, 2 dotted style1["hz_line_type"] = 2 t.children[0].img_style = style1 t.children[1].img_style = style1 # Set dashed blue lines in all leaves style2 = NodeStyle() style2["fgcolor"] = "#000000" style2["shape"] = "circle" style2["vt_line_color"] = "#0000aa" style2["hz_line_color"] = "#0000aa" style2["vt_line_width"] = 2 style2["hz_line_width"] = 2 style2["vt_line_type"] = 1 # 0 solid, 1 dashed, 2 dotted style2["hz_line_type"] = 1 for l in t.iter_leaves(): l.img_style = style2 ts = TreeStyle() ts.layout_fn = layout ts.show_leaf_name = False return t, ts
def _get_motif_tree(tree, data, circle=True, vmin=None, vmax=None): try: from ete3 import Tree, NodeStyle, TreeStyle except ImportError: print("Please install ete3 to use this functionality") sys.exit(1) t = Tree(tree) # Determine cutoff for color scale if not (vmin and vmax): for i in range(90, 101): minmax = np.percentile(data.values, i) if minmax > 0: break if not vmin: vmin = -minmax if not vmax: vmax = minmax norm = Normalize(vmin=vmin, vmax=vmax, clip=True) mapper = cm.ScalarMappable(norm=norm, cmap="RdBu_r") m = 25 / data.values.max() for node in t.traverse("levelorder"): val = data[[l.name for l in node.get_leaves()]].values.mean() style = NodeStyle() style["size"] = 0 style["hz_line_color"] = to_hex(mapper.to_rgba(val)) style["vt_line_color"] = to_hex(mapper.to_rgba(val)) v = max(np.abs(m * val), 5) style["vt_line_width"] = v style["hz_line_width"] = v node.set_style(style) ts = TreeStyle() ts.layout_fn = _tree_layout ts.show_leaf_name = False ts.show_scale = False ts.branch_vertical_margin = 10 if circle: ts.mode = "c" ts.arc_start = 180 # 0 degrees = 3 o'clock ts.arc_span = 180 return t, ts
def _get_motif_tree(tree, data, circle=True, vmin=None, vmax=None): try: from ete3 import Tree, NodeStyle, TreeStyle except ImportError: print("Please install ete3 to use this functionality") sys.exit(1) t = Tree(tree) # Determine cutoff for color scale if not(vmin and vmax): for i in range(90, 101): minmax = np.percentile(data.values, i) if minmax > 0: break if not vmin: vmin = -minmax if not vmax: vmax = minmax norm = Normalize(vmin=vmin, vmax=vmax, clip=True) mapper = cm.ScalarMappable(norm=norm, cmap="RdBu_r") m = 25 / data.values.max() for node in t.traverse("levelorder"): val = data[[l.name for l in node.get_leaves()]].values.mean() style = NodeStyle() style["size"] = 0 style["hz_line_color"] = to_hex(mapper.to_rgba(val)) style["vt_line_color"] = to_hex(mapper.to_rgba(val)) v = max(np.abs(m * val), 5) style["vt_line_width"] = v style["hz_line_width"] = v node.set_style(style) ts = TreeStyle() ts.layout_fn = _tree_layout ts.show_leaf_name= False ts.show_scale = False ts.branch_vertical_margin = 10 if circle: ts.mode = "c" ts.arc_start = 180 # 0 degrees = 3 o'clock ts.arc_span = 180 return t, ts
def run_action_change_style(self, tree, a_data): #print "action change style called.." if tree.tree_style == self._treestyle: ts2 = TreeStyle() ts2.layout_fn = self.custom_layout ts2.show_leaf_name = False ts2.draw_guiding_lines = True ts2.guiding_lines_type = 0 #solid line ts2.guiding_lines_color = a_data tree.tree_style = ts2 self._treestyle = ts2 else: tree.tree_style = self._treestyle
def get_style(): # Create an empty TreeStyle ts = TreeStyle() # Set our custom layout function ts.layout_fn = layout # Draw a tree ts.mode = "c" # We will add node names manually ts.show_leaf_name = True # Show branch data ts.show_branch_length = True ts.show_branch_support = True return ts
def draw_ete3_tree(organism, snplist, tree_file_name, config, c): '''Draws a phylogenetic tree using ETE3 Keyword arguments: organism -- the organism of which to make a tree snplist -- a list of the SNP names, positions and state file_name -- the name of the out-file _tree.pdf will be added ''' newick = tree_to_newick(organism, config, c) tree = Tree(newick, format=1) tree_depth = int(tree.get_distance(tree.get_farthest_leaf()[0])) for n in tree.traverse(): # Nodes are set to red colour nstyle = NodeStyle() nstyle["fgcolor"] = "#BE0508" nstyle["size"] = 10 nstyle["vt_line_color"] = "#000000" nstyle["hz_line_color"] = "#000000" nstyle["vt_line_type"] = 0 nstyle["hz_line_type"] = 0 nstyle["vt_line_width"] = 2 nstyle["hz_line_width"] = 2 ## ['B.3', 'T', 'C', 'A'] for snp in snplist.keys(): if n.name == snp and snplist[snp] == 0: # If the SNP is missing due to a gap, make it grey nstyle["fgcolor"] = "#DDDDDD" nstyle["size"] = 10 nstyle["vt_line_color"] = "#DDDDDD" nstyle["hz_line_color"] = "#DDDDDD" nstyle["vt_line_type"] = 1 nstyle["hz_line_type"] = 1 elif n.name == snp and snplist[snp] == 1: nstyle["fgcolor"] = "#99FF66" nstyle["size"] = 15 nstyle["vt_line_color"] = "#000000" nstyle["hz_line_color"] = "#000000" nstyle["vt_line_type"] = 0 nstyle["hz_line_type"] = 0 n.set_style(nstyle) ts = TreeStyle() ts.show_leaf_name = False # Do not print(leaf names, they are added in layout) ts.show_scale = False # Do not show the scale ts.layout_fn = self.CanSNPer_tree_layout # Use the custom layout ts.optimal_scale_level = 'full' # Fully expand the branches of the tree if config["dev"]: print("#[DEV] Tree file: %s" % tree_file_name) tree.render(tree_file_name, tree_style=ts, width=tree_depth * 500)
def tree2img(newick_tree, save_path): t = Tree(newick_tree, format=1) ts = TreeStyle() ts.show_leaf_name = False ts.show_branch_length = False ts.show_branch_support = False def my_layout(node): F = TextFace(node.name, tight_text=True) add_face_to_node(F, node, column=0, position="branch-right") ts.layout_fn = my_layout ts.branch_vertical_margin = 10 ts.rotation = 90 t.render(save_path+'png', tree_style=ts) t.render(save_path+'svg', tree_style=ts)
def plot_taxids(taxids_list, tree_png, tree_nw, tax_db=None): if tax_db is not None: ncbi = NCBITaxa(dbfile=tax_db) else: ncbi=NCBITaxa() tree = ncbi.get_topology(taxids_list) ts = TreeStyle() ncbi.annotate_tree(tree, taxid_attr="sci_name") ts.show_leaf_name = False ts.mode = "c" ts.layout_fn = layout tree.render(tree_png, tree_style=ts) tree.write(format=1, outfile=tree_nw)
def get_example_tree(): # Create a random tree and add to each leaf a random set of motifs # from the original set t = Tree() t.populate(10) # for l in t.iter_leaves(): # seq_motifs = [list(m) for m in motifs] #sample(motifs, randint(2, len(motifs))) # seqFace = SeqMotifFace(seq, seq_motifs, intermotif_format="line", # seqtail_format="compactseq", scale_factor=1) # seqFace.margin_bottom = 4 # f = l.add_face(seqFace, 0, "aligned") ts = TreeStyle() ts.layout_fn = layout return t, ts
def draw_tree(tree_string): t = Tree(tree_string, format=8) def mylayout(node): #if node.name != 'L': file = 'tmp/%s.png' % node.name new_face = faces.ImgFace(file) new_face.rotable = True new_face.rotation = -90 #new_face.margin_top = 50 new_face.margin_left = 15 faces.add_face_to_node(new_face, node, column=0 , position='branch-top') ts = TreeStyle() ts.rotation = 90 ts.layout_fn = mylayout t.show(tree_style = ts) plt.clf()
def draw_tree(tree, conf, outfile): try: from ete3 import (add_face_to_node, AttrFace, TextFace, TreeStyle, RectFace, CircleFace, SequenceFace, random_color, SeqMotifFace) except ImportError as e: print(e) return def ly_basic(node): if node.is_leaf(): node.img_style['size'] = 0 else: node.img_style['size'] = 0 node.img_style['shape'] = 'square' if len(MIXED_RES) > 1 and hasattr(node, "tree_seqtype"): if node.tree_seqtype == "nt": node.img_style["bgcolor"] = "#CFE6CA" ntF = TextFace("nt", fsize=6, fgcolor='#444', ftype='Helvetica') add_face_to_node(ntF, node, 10, position="branch-bottom") if len(NPR_TREES) > 1 and hasattr(node, "tree_type"): node.img_style['size'] = 4 node.img_style['fgcolor'] = "steelblue" node.img_style['hz_line_width'] = 1 node.img_style['vt_line_width'] = 1 def ly_leaf_names(node): if node.is_leaf(): spF = TextFace(node.species, fsize=10, fgcolor='#444444', fstyle='italic', ftype='Helvetica') add_face_to_node(spF, node, column=0, position='branch-right') if hasattr(node, 'genename'): geneF = TextFace(" (%s)" %node.genename, fsize=8, fgcolor='#777777', ftype='Helvetica') add_face_to_node(geneF, node, column=1, position='branch-right') def ly_supports(node): if not node.is_leaf() and node.up: supFace = TextFace("%0.2g" %(node.support), fsize=7, fgcolor='indianred') add_face_to_node(supFace, node, column=0, position='branch-top') def ly_tax_labels(node): if node.is_leaf(): c = LABEL_START_COL largest = 0 for tname in TRACKED_CLADES: if hasattr(node, "named_lineage") and tname in node.named_lineage: linF = TextFace(tname, fsize=10, fgcolor='white') linF.margin_left = 3 linF.margin_right = 2 linF.background.color = lin2color[tname] add_face_to_node(linF, node, c, position='aligned') c += 1 for n in range(c, len(TRACKED_CLADES)): add_face_to_node(TextFace('', fsize=10, fgcolor='slategrey'), node, c, position='aligned') c+=1 def ly_full_alg(node): pass def ly_block_alg(node): if node.is_leaf(): if 'sequence' in node.features: seqFace = SeqMotifFace(node.sequence, []) # [10, 100, "[]", None, 10, "black", "rgradient:blue", "arial|8|white|domain Name"], motifs = [] last_lt = None for c, lt in enumerate(node.sequence): if lt != '-': if last_lt is None: last_lt = c if c+1 == len(node.sequence): start, end = last_lt, c motifs.append([start, end, "()", 0, 12, "slategrey", "slategrey", None]) last_lt = None elif lt == '-': if last_lt is not None: start, end = last_lt, c-1 motifs.append([start, end, "()", 0, 12, "grey", "slategrey", None]) last_lt = None seqFace = SeqMotifFace(node.sequence, motifs, intermotif_format="line", seqtail_format="line", scale_factor=ALG_SCALE) add_face_to_node(seqFace, node, ALG_START_COL, aligned=True) TRACKED_CLADES = ["Eukaryota", "Viridiplantae", "Fungi", "Alveolata", "Metazoa", "Stramenopiles", "Rhodophyta", "Amoebozoa", "Crypthophyta", "Bacteria", "Alphaproteobacteria", "Betaproteobacteria", "Cyanobacteria", "Gammaproteobacteria",] # ["Opisthokonta", "Apicomplexa"] colors = random_color(num=len(TRACKED_CLADES), s=0.45) lin2color = dict([(ln, colors[i]) for i, ln in enumerate(TRACKED_CLADES)]) NAME_FACE = AttrFace('name', fsize=10, fgcolor='#444444') LABEL_START_COL = 10 ALG_START_COL = 40 ts = TreeStyle() ts.draw_aligned_faces_as_table = False ts.draw_guiding_lines = False ts.show_leaf_name = False ts.show_branch_support = False ts.scale = 160 ts.layout_fn = [ly_basic, ly_leaf_names, ly_supports, ly_tax_labels] MIXED_RES = set() MAX_SEQ_LEN = 0 NPR_TREES = [] for n in tree.traverse(): if hasattr(n, "tree_seqtype"): MIXED_RES.add(n.tree_seqtype) if hasattr(n, "tree_type"): NPR_TREES.append(n.tree_type) seq = getattr(n, "sequence", "") MAX_SEQ_LEN = max(len(seq), MAX_SEQ_LEN) if MAX_SEQ_LEN: ALG_SCALE = min(1, 1000./MAX_SEQ_LEN) ts.layout_fn.append(ly_block_alg) if len(NPR_TREES) > 1: rF = RectFace(4, 4, "steelblue", "steelblue") rF.margin_right = 10 rF.margin_left = 10 ts.legend.add_face(rF, 0) ts.legend.add_face(TextFace(" NPR node"), 1) ts.legend_position = 3 if len(MIXED_RES) > 1: rF = RectFace(20, 20, "#CFE6CA", "#CFE6CA") rF.margin_right = 10 rF.margin_left = 10 ts.legend.add_face(rF, 0) ts.legend.add_face(TextFace(" Nucleotide based alignment"), 1) ts.legend_position = 3 try: tree.set_species_naming_function(spname) annotate_tree_with_ncbi(tree) a = tree.search_nodes(species='Dictyostelium discoideum')[0] b = tree.search_nodes(species='Chondrus crispus')[0] #out = tree.get_common_ancestor([a, b]) #out = tree.search_nodes(species='Haemophilus parahaemolyticus')[0].up tree.set_outgroup(out) tree.swap_children() except Exception: pass tree.render(outfile, tree_style=ts, w=170, units='mm', dpi=150) tree.render(outfile+'.svg', tree_style=ts, w=170, units='mm', dpi=150) tree.render(outfile+'.pdf', tree_style=ts, w=170, units='mm', dpi=150)
def run(args): if args.text_mode: from ete3 import Tree for tindex, tfile in enumerate(args.src_tree_iterator): #print tfile if args.raxml: nw = re.sub(":(\d+\.\d+)\[(\d+)\]", ":\\1[&&NHX:support=\\2]", open(tfile).read()) t = Tree(nw) else: t = Tree(tfile) print(t.get_ascii(show_internal=args.show_internal_names, attributes=args.show_attributes)) return import random import re import colorsys from collections import defaultdict from ete3 import (Tree, PhyloTree, TextFace, RectFace, faces, TreeStyle, add_face_to_node, random_color) global FACES if args.face: FACES = parse_faces(args.face) else: FACES = [] # VISUALIZATION ts = TreeStyle() ts.mode = args.mode ts.show_leaf_name = True ts.tree_width = args.tree_width for f in FACES: if f["value"] == "@name": ts.show_leaf_name = False break if args.as_ncbi: ts.show_leaf_name = False FACES.extend(parse_faces( ['value:@sci_name, size:10, fstyle:italic', 'value:@taxid, color:grey, size:6, format:" - %s"', 'value:@sci_name, color:steelblue, size:7, pos:b-top, nodetype:internal', 'value:@rank, color:indianred, size:6, pos:b-bottom, nodetype:internal', ])) if args.alg: FACES.extend(parse_faces( ['value:@sequence, size:10, pos:aligned, ftype:%s' %args.alg_type] )) if args.heatmap: FACES.extend(parse_faces( ['value:@name, size:10, pos:aligned, ftype:heatmap'] )) if args.bubbles: for bubble in args.bubbles: FACES.extend(parse_faces( ['value:@%s, pos:float, ftype:bubble, opacity:0.4' %bubble, ])) ts.branch_vertical_margin = args.branch_separation if args.show_support: ts.show_branch_support = True if args.show_branch_length: ts.show_branch_length = True if args.force_topology: ts.force_topology = True ts.layout_fn = lambda x: None for tindex, tfile in enumerate(args.src_tree_iterator): #print tfile if args.raxml: nw = re.sub(":(\d+\.\d+)\[(\d+)\]", ":\\1[&&NHX:support=\\2]", open(tfile).read()) t = PhyloTree(nw) else: t = PhyloTree(tfile) if args.alg: t.link_to_alignment(args.alg, alg_format=args.alg_format) if args.heatmap: DEFAULT_COLOR_SATURATION = 0.3 BASE_LIGHTNESS = 0.7 def gradient_color(value, max_value, saturation=0.5, hue=0.1): def rgb2hex(rgb): return '#%02x%02x%02x' % rgb def hls2hex(h, l, s): return rgb2hex( tuple([int(x*255) for x in colorsys.hls_to_rgb(h, l, s)])) lightness = 1 - (value * BASE_LIGHTNESS) / max_value return hls2hex(hue, lightness, DEFAULT_COLOR_SATURATION) heatmap_data = {} max_value, min_value = None, None for line in open(args.heatmap): if line.startswith('#COLNAMES'): pass elif line.startswith('#') or not line.strip(): pass else: fields = line.split('\t') name = fields[0].strip() values = [float(x) if x else None for x in fields[1:]] maxv = max(values) minv = min(values) if max_value is None or maxv > max_value: max_value = maxv if min_value is None or minv < min_value: min_value = minv heatmap_data[name] = values heatmap_center_value = 0 heatmap_color_center = "white" heatmap_color_up = 0.3 heatmap_color_down = 0.7 heatmap_color_missing = "black" heatmap_max_value = abs(heatmap_center_value - max_value) heatmap_min_value = abs(heatmap_center_value - min_value) if heatmap_center_value <= min_value: heatmap_max_value = heatmap_min_value + heatmap_max_value else: heatmap_max_value = max(heatmap_min_value, heatmap_max_value) # scale the tree if not args.height: args.height = None if not args.width: args.width = None f2color = {} f2last_seed = {} for node in t.traverse(): node.img_style['size'] = 0 if len(node.children) == 1: node.img_style['size'] = 2 node.img_style['shape'] = "square" node.img_style['fgcolor'] = "steelblue" ftype_pos = defaultdict(int) for findex, f in enumerate(FACES): if (f['nodetype'] == 'any' or (f['nodetype'] == 'leaf' and node.is_leaf()) or (f['nodetype'] == 'internal' and not node.is_leaf())): # if node passes face filters if node_matcher(node, f["filters"]): if f["value"].startswith("@"): fvalue = getattr(node, f["value"][1:], None) else: fvalue = f["value"] # if node's attribute has content, generate face if fvalue is not None: fsize = f["size"] fbgcolor = f["bgcolor"] fcolor = f['color'] if fcolor: # Parse color options auto_m = re.search("auto\(([^)]*)\)", fcolor) if auto_m: target_attr = auto_m.groups()[0].strip() if not target_attr : color_keyattr = f["value"] else: color_keyattr = target_attr color_keyattr = color_keyattr.lstrip('@') color_bin = getattr(node, color_keyattr, None) last_seed = f2last_seed.setdefault(color_keyattr, random.random()) seed = last_seed + 0.10 + random.uniform(0.1, 0.2) f2last_seed[color_keyattr] = seed fcolor = f2color.setdefault(color_bin, random_color(h=seed)) if fbgcolor: # Parse color options auto_m = re.search("auto\(([^)]*)\)", fbgcolor) if auto_m: target_attr = auto_m.groups()[0].strip() if not target_attr : color_keyattr = f["value"] else: color_keyattr = target_attr color_keyattr = color_keyattr.lstrip('@') color_bin = getattr(node, color_keyattr, None) last_seed = f2last_seed.setdefault(color_keyattr, random.random()) seed = last_seed + 0.10 + random.uniform(0.1, 0.2) f2last_seed[color_keyattr] = seed fbgcolor = f2color.setdefault(color_bin, random_color(h=seed)) if f["ftype"] == "text": if f.get("format", None): fvalue = f["format"] % fvalue F = TextFace(fvalue, fsize = fsize, fgcolor = fcolor or "black", fstyle = f.get('fstyle', None)) elif f["ftype"] == "fullseq": F = faces.SeqMotifFace(seq=fvalue, seq_format="seq", seqtail_format="seq", height=fsize) elif f["ftype"] == "compactseq": F = faces.SeqMotifFace(seq=fvalue, seq_format="compactseq", seqtail_format="compactseq", height=fsize) elif f["ftype"] == "blockseq": F = faces.SeqMotifFace(seq=fvalue, seq_format="blockseq", seqtail_format="blockseq", height=fsize, fgcolor=fcolor or "slategrey", bgcolor=fbgcolor or "slategrey", scale_factor = 1.0) fbgcolor = None elif f["ftype"] == "bubble": try: v = float(fvalue) except ValueError: rad = fsize else: rad = fsize * v F = faces.CircleFace(radius=rad, style="sphere", color=fcolor or "steelblue") elif f["ftype"] == "heatmap": if not f['column']: col = ftype_pos[f["pos"]] else: col = f["column"] for i, value in enumerate(heatmap_data.get(node.name, [])): ftype_pos[f["pos"]] += 1 if value is None: color = heatmap_color_missing elif value > heatmap_center_value: color = gradient_color(abs(heatmap_center_value - value), heatmap_max_value, hue=heatmap_color_up) elif value < heatmap_center_value: color = gradient_color(abs(heatmap_center_value - value), heatmap_max_value, hue=heatmap_color_down) else: color = heatmap_color_center node.add_face(RectFace(20, 20, color, color), position="aligned", column=col + i) # Add header # for i, name in enumerate(header): # nameF = TextFace(name, fsize=7) # nameF.rotation = -90 # tree_style.aligned_header.add_face(nameF, column=i) F = None elif f["ftype"] == "profile": # internal profiles? F = None elif f["ftype"] == "barchart": F = None elif f["ftype"] == "piechart": F = None # Add the Face if F: F.opacity = f['opacity'] or 1.0 # Set face general attributes if fbgcolor: F.background.color = fbgcolor if not f['column']: col = ftype_pos[f["pos"]] ftype_pos[f["pos"]] += 1 else: col = f["column"] node.add_face(F, column=col, position=f["pos"]) if args.image: t.render("t%d.%s" %(tindex, args.image), tree_style=ts, w=args.width, h=args.height, units=args.size_units) else: t.show(None, tree_style=ts)
Rangifer_tarandus,http://media.eol.org/content/2014/05/02/09/88803_98_68.jpg,109.09,herbivore Cervus_elaphus,http://media.eol.org/content/2013/02/22/16/31998_98_68.jpg,240.87,herbivore Bos_taurus,http://media.eol.org/content/2014/09/29/06/46535_98_68.jpg,618.64,herbivore Ovis_orientalis,http://media.eol.org/content/2015/01/04/05/30107_98_68.jpg,39.1,herbivore Suricata_suricatta,http://media.eol.org/content/2012/06/19/04/84840_98_68.jpg,0.73,carnivore Mephitis_mephitis,http://media.eol.org/content/2012/08/30/16/23686_98_68.jpg,2.4,omnivore""" tip2info = {} for line in tip_info_csv.split('\n'): if line: name, url, mass, habit = map(str.strip, line.split(',')) tip2info[name] = [url, mass, habit] # Server configuration ts = TreeStyle() ts.layout_fn = custom_layout ts.show_leaf_name = False ts2 = TreeStyle() actions = NodeActions() actions.add_action('Root here', show_action_root, run_action_root, None) actions.add_action('Highlight', show_action_highlight, run_action_highlight, None) actions.add_action('Change style', show_action_change_style, run_action_change_style, None) actions.add_action('EOL link', show_eol_link, None, eol_link) actions.add_action('Change color', show_action_linecolor, None, change_linecolor) start_server(node_actions=actions, tree_style=ts)
if "highlighted" in node.features: node.img_style["bgcolor"] = "LightCyan" if "improve" in node.features: color = "orange" if float(node.improve) < 0 else "green" if float(node.improve) == 0: color = "blue" support_face = faces.CircleFace(200, color) faces.add_face_to_node(support_face, node, 0, position="float-behind") try: from ete3 import TreeStyle, NodeStyle, faces from ete3.treeview import random_color NPR_TREE_STYLE = TreeStyle() NPR_TREE_STYLE.layout_fn = npr_layout NPR_TREE_STYLE.show_leaf_name = False except ImportError: TreeStyle, NodeStyle, faces, random_color = [None]*4 NPR_TREE_STYLE = None # CONVERT shell colors to the same curses palette COLORS = { "wr": '\033[1;37;41m', # white on red "wo": '\033[1;37;43m', # white on orange "wm": '\033[1;37;45m', # white on magenta "wb": '\033[1;37;46m', # white on blue "bw": '\033[1;37;40m', # black on white "lblue": '\033[1;34m', # light blue
# # add names to all nodes (not just to leaf nodes) # ete3/test/test_treeview/face_rotation.py F = TextFace(node.name, tight_text=True) add_face_to_node(F, node, column=0, position="branch-right") # # add branch lengths # ete3/treeview/qt4_render.py if not node.is_root(): bl_face = AttrFace("dist", fsize=8, ftype="Arial", fgcolor="black", formatter="%0.3g") # # This is a failed attempt to center the branch length text on the branch. #a = 1 # 0 left, 1 center, 2 right #bl_face.hz_align = a #bl_face.vt_align = a #add_face_to_node(bl_face, node, column=0, aligned=True, position="branch-top") add_face_to_node(bl_face, node, column=0, position="branch-top") # # I guess we also have to explicitly add the alignment column # if we are overriding the layout function. # ete3/treeview/layouts.py : phylogeny(node) if hasattr(node, 'sequence'): seq_face = SequenceFace(node.sequence, seqtype='nt', fsize=13) seq_face.margin_left = 4 add_face_to_node(seq_face, node, column=1, aligned=True) ts.layout_fn = my_layout t.render('treefig.png', tree_style=ts)
# for key in prune_count.keys(): # # node_weight = ln(prune_count[key]) # # node_weight = ln(n_children) # # print(node_weight,n_children) # # node = lookup[key] # node.add_features(weight=random.randint(50)) for n in t.traverse(): n.add_face(TextFace(n.name, fsize = 16), column=0, position="branch-bottom") # n.add_features(weight=random.randint(0,20)) t.prune(prune_list) # Create an empty TreeStyle ts = TreeStyle() # Set our custom layout function ts.layout_fn = layout # Draw a tree # ts.mode = "c" # this makes it circular # False need to add node names manually ts.show_leaf_name = False ts.scale = 120 # Show branch data ts.show_branch_length = False ts.show_branch_support = True # print (t.get_ascii(show_internal=True)) t.show(tree_style=ts)
concord_text = faces.TextFace(str(int(concord_dict[mynode.name]))+' ',fsize=20) conflict_text = faces.TextFace(str(int(conflict_dict[mynode.name]))+' ',fsize=20) faces.add_face_to_node(concord_text,mynode,0,position = "branch-top") faces.add_face_to_node(conflict_text,mynode,0,position="branch-bottom") else: F = faces.TextFace(mynode.name,fsize=20) faces.add_face_to_node(F,mynode,0,position="aligned") #Plot Pie Chart ts = TreeStyle() ts.show_leaf_name = False ts.layout_fn = phyparts_pie_layout nstyle = NodeStyle() nstyle["size"] = 0 for n in plot_tree.traverse(): n.set_style(nstyle) n.img_style["vt_line_width"] = 0 ts.draw_guiding_lines = True ts.guiding_lines_color = "black" ts.guiding_lines_type = 0 ts.scale = 30 ts.branch_vertical_margin = 10 plot_tree.convert_to_ultrametric() plot_tree.ladderize(direction=1) my_svg = plot_tree.render(args.svg_name,tree_style=ts,w=595,dpi=300)
def balancetest(table, grouping, tree, significance_test=None, layout=None, normalize=True, mode='c'): """ Performs statistical test on ilr balances and plots on tree. Parameters ---------- table : pd.DataFrame A 2D matrix of strictly positive values (i.e. counts or proportions) where the rows correspond to samples and the columns correspond to features. grouping : pd.Series Vector indicating the assignment of samples to groups. For example, these could be strings or integers denoting which group a sample belongs to. It must be the same length as the samples in `table`. The index must be the same on `table` and `grouping` but need not be in the same order. tree : skbio.TreeNode A strictly bifurcating tree defining a hierarchical relationship between all of the features within `table` significance_test : function, optional A statistical significance function to test for significance between classes. This function must be able to accept at least two 1D array_like arguments of floats and returns a test statistic and a p-value, or a single statistic. By default ``scipy.stats.f_oneway`` is used. layout : function, optional A layout for formatting the tree visualization. Must take a `ete.tree` as a parameter. mode : str Type of display to show the tree. ('c': circular, 'r': rectangular). Returns ------- ete_tree : ete.Tree ETE tree converted from the `skbio.TreeNode` object ts : ete.TreeStyle ETE tree style used for formatting the visualized tree, with the test statistic plotted on each of the internal nodes. Note ---- The `skbio.TreeNode` is assumed to strictly bifurcating and whose tips match `table`. Also, it is assumed that none of the values in `table` are zero. Replace with a pseudocount if necessary. See also -------- skbio.TreeNode.bifurcate skbio.stats.composition.ilr skbio.stats.multiplicative_replacement scipy.stats.f_oneway """ if np.any(table <= 0): raise ValueError('Cannot handle zeros or negative values in `table`. ' 'Use pseudo counts or ``multiplicative_replacement``.' ) if significance_test is None: significance_test = scipy.stats.f_oneway sorted_features = [n.name for n in tree.tips()][::-1] if len(sorted_features) != len(table.columns): raise ValueError('The number of tips (%d) in the tree must be equal ' 'to the number features in the table (%d).' % (len(sorted_features), len(table.columns))) table = table.reindex(columns=sorted_features) mat, cats = check_table_grouping(table, grouping) basis, nodes = phylogenetic_basis(tree) ilr_coords = ilr(mat, basis=basis) ete_tree = Tree(str(tree)) _cats = set(cats) i = 0 for n in ete_tree.traverse(): if not n.is_leaf(): diffs = [ilr_coords[(cats == x).values, i] for x in _cats] stat = significance_test(*diffs) if len(stat) == 2: n.add_features(weight=-np.log(stat[1])) elif len(stat) == 1: n.add_features(weight=stat) else: raise ValueError( "Too many arguments returned by %s" % significance_test.__name__) i += 1 # Create an empty TreeStyle ts = TreeStyle() # Set our custom layout function if layout is None: ts.layout_fn = default_layout else: ts.layout_fn = layout # Draw a tree ts.mode = mode # We will add node names manually ts.show_leaf_name = False # Show branch data ts.show_branch_length = True ts.show_branch_support = True return ete_tree, ts
>Chimp HARWLNEKLRCELRTLKKLGLDGYKAVSQYVKGRA >Orangutan DARWINEKLRCVSRTLKKLGLDGYKGVSQYVKGRP >Human DARWHNVKLRCELRTLKKLGLVGFKAVSQFVIRRA """) nt_sequences = {"Human" : "GACGCACGGTGGCACAACGTAAAATTAAGATGTGAATTGAGAACTCTGAAAAAATTGGGACTGGTCGGCTTCAAGGCAGTAAGTCAATTCGTAATACGTCGTGCG", "Chimp" : "CACGCCCGATGGCTCAACGAAAAGTTAAGATGCGAATTGAGAACTCTGAAAAAATTGGGACTGGACGGCTACAAGGCAGTAAGTCAGTACGTTAAAGGTCGTGCG", "Orangutan": "GATGCACGCTGGATCAACGAAAAGTTAAGATGCGTATCGAGAACTCTGAAAAAATTGGGACTGGACGGCTACAAGGGAGTAAGTCAATACGTTAAAGGTCGTCCG" } for l in nt_sequences: (tree & l).nt_sequence = nt_sequences[l] tree.dist = 0 ts = TreeStyle() ts.title.add_face(TextFace("Example for nucleotides...", fsize=15), column=0) ts.layout_fn = test_layout_evol tree.show(tree_style=ts) # Show very large algs tree = PhyloTree('(Orangutan,Human,Chimp);') tree.link_to_alignment(">Human\n" + ''.join([_aabgcolors.keys()[int(random() * len (_aabgcolors))] for _ in xrange (5000)]) + \ "\n>Chimp\n" + ''.join([_aabgcolors.keys()[int(random() * len (_aabgcolors))] for _ in xrange (5000)]) + \ "\n>Orangutan\n" + ''.join([_aabgcolors.keys()[int(random() * len (_aabgcolors))] for _ in xrange (5000)])) tree.dist = 0 ts = TreeStyle() ts.title.add_face(TextFace("better not set interactivity if alg is very large", fsize=15), column=0) ts.layout_fn = test_layout_phylo_aa tree.show(tree_style=ts)
def main(args): if args.alignment: t = PhyloTree(args.tree, alignment=args.alignment, alg_format='fasta') else: t = PhyloTree(args.tree) if args.highlight_new: runs = read_runs(args.highlight_new) t.set_outgroup('EM_079422') t.ladderize() ts = TreeStyle() ts.show_leaf_name = False ts.show_branch_support = False ts.layout_fn = layout thick_hz_line = NodeStyle() thick_hz_line["hz_line_width"] = 8 t.set_style(thick_hz_line) #t.children[0].set_style(thick_hz_line) #t.children[1].set_style(thick_hz_line) thick_vt_line = NodeStyle() thick_vt_line["vt_line_width"] = 4 t.set_style(thick_vt_line) # header if not args.hide_annotations: ts.aligned_header.add_face(MyTextFace('Sample identifier', fstyle='Bold', fsize=8, tight_text=False), column = 1) ts.aligned_header.add_face(MyTextFace('Prefecture', fstyle='Bold', fsize=8, tight_text=False), column = 2) ts.aligned_header.add_face(MyTextFace('Sous-prefecture', fstyle='Bold', fsize=8, tight_text=False), column = 3) ts.aligned_header.add_face(MyTextFace('Village', fstyle='Bold', fsize=8, tight_text=False), column = 4) ts.aligned_header.add_face(MyTextFace('Sample received', fstyle='Bold', fsize=8, tight_text=False), column = 5) if args.positions: positions = read_positions(args.positions) alg_header = RulerFace(positions, col_width=11, height=0, # set to 0 if dont want to use values kind="stick", hlines = [0], hlines_col = ["white"], # trick to hide hz line ) ts.aligned_header.add_face(alg_header, 6) #legend if args.legend: legend = {} for s in samples.values(): legend[s['prefec']] = s['prefec__colour'] for p in sorted(legend.keys()): ts.legend.add_face(CircleFace(4, legend[p]), column=0) ts.legend.add_face(MyTextFace(p, fsize=6, tight_text=False), column=1) ts.legend_position=1 if args.circular: ts.mode = "c" ts.arc_start = -180 # 0 degrees = 3 o'clock ts.arc_span = 180 # t.show(tree_style=ts) t.render(args.output, tree_style=ts, w=1024)
# If node is internal else: # If silhouette is good, creates a green bubble if node.silhouette>0: validationFace = TextFace("Silh=%0.2f" %node.silhouette, "Verdana", 10, "#056600") node.img_style["fgcolor"]="#056600" # Otherwise, use red bubbles else: validationFace = TextFace("Silh=%0.2f" %node.silhouette, "Verdana", 10, "#940000") node.img_style["fgcolor"]="#940000" # Sets node size proportional to the silhouette value. node.img_style["shape"]="sphere" if node.silhouette<=1 and node.silhouette>=-1: node.img_style["size"]= 15+int((abs(node.silhouette)*10)**2) # If node is very internal, draw also a bar diagram # with the average expression of the partition add_face_to_node(validationFace, node, 0) if len(node)>100: add_face_to_node(cbarsFace, node, 1) # Use my layout to visualize the tree ts = TreeStyle() ts.layout_fn = mylayout t.children[0].show(tree_style=ts)