def hmmhit2pacbp(queryorf, queryorg, querycoords, sbjctorf, sbjctorg, hmmhit, verbose=False): """ """ # trim hmmhit for unmatched characters (sbjct_header, sbjct_start, sbjct_end, query_start, query_end, query, match, sbjct, score, expect) = hmmhit while match and match[0] == ' ': query = query[1:] match = match[1:] sbjct = sbjct[1:] sbjct_start += 1 query_start += 1 while match and match[-1] == ' ': query = query[0:-1] match = match[0:-1] sbjct = sbjct[0:-1] sbjct_end -= 1 query_end -= 1 # get orf, node and AA and DNA coordinates of this sbjct hit; # correct for -1 offset in start coordinate!! sbjct_aa_start = sbjct_start - 1 + sbjctorf.protein_startPY sbjct_aa_end = sbjct_end + sbjctorf.protein_startPY sbjctNode = (sbjctorg, sbjctorf.id) query = query.replace(".", "-").upper() sbjct = sbjct.replace(".", "-").upper() ############################################################################ if verbose: print "hmmhit2pacbp CREATING pacbps for organism/orf: (%s,%s)" % ( sbjctorg, sbjctorf.id) print "hmmhit2pacbp Q '%s'" % query print "hmmhit2pacbp m '%s'" % match print "hmmhit2pacbp S '%s'" % sbjct print "hmmQ:", query, query_start, query_end, "gaps:", print query.count('-'), len(query) print "hmmM:", match print "hmmS:", sbjct, sbjctNode, sbjct_aa_start, sbjct_aa_end, print "len:", sbjct_aa_end - sbjct_aa_start, len(sbjct) ############################################################################ # get Node and sequence of the query queryNode = (queryorg, queryorf.id) queryseq = deepcopy(query) # calculate query sequence position on queryorf query_aa_start = querycoords[0] + query_start - 1 query_aa_end = query_aa_start + len(queryseq) - queryseq.count('-') ############################################################################ if verbose: print "hmmq:", queryseq, queryNode, query_aa_start, query_aa_end, print "len:", query_aa_end - query_aa_start, len(queryseq) ############################################################################ # make a deepcopy; sbjct is needed unchanged for the next iteration # in the for loop, but here we want to trim of gap sequences sbjctseq = deepcopy(sbjct) sbjctaastart = deepcopy(sbjct_aa_start) sbjctaaend = deepcopy(sbjct_aa_end) while queryseq and queryseq[0] == '-': queryseq = queryseq[1:] sbjctseq = sbjctseq[1:] sbjctaastart += 1 while sbjctseq and sbjctseq[0] == '-': queryseq = queryseq[1:] sbjctseq = sbjctseq[1:] query_aa_start += 1 while queryseq and queryseq[-1] == '-': queryseq = queryseq[0:-1] sbjctseq = sbjctseq[0:-1] sbjctaaend -= 1 while sbjctseq and sbjctseq[-1] == '-': queryseq = queryseq[0:-1] sbjctseq = sbjctseq[0:-1] query_aa_end -= 1 # NEW NEW code in december 2010. Since inwpCBGs are implemented, HMM # profiles are build from clustalw alignments which have loosely aligned # tails (SPRDIF sequences). Problem with HMM is, that in the result file # no information is written on where in teh constructed HMM this hit # starts. This **sucks** because special care was taken in ABFGP code to # make shure the exact aa-coordinates of the applied sequences to ClustalW # are known. Hmmbuild here nullifies this effort by not giving start # coordinates. Therefore, we have to check the exact start position # of the HMM match on the queryorf. if queryseq.replace("-", "") != queryorf.getaas(query_aa_start, query_aa_end): # obtain (search) query sequence, replace gaps by X symbol searchqueryseq = queryseq.upper().replace("-", "X") # count length of the query sequence; here IGNORE THE GAPS!! seqlen = len(queryseq.upper().replace("-", "")) # make fasta sequence dictionary seqdict = { 'query_hmm': searchqueryseq, 'query_orf': queryorf.protein_sequence, } # make coords dictionary for remapping coords = { 'query_hmm': [0, seqlen], 'query_orf': [queryorf.protein_startPY, queryorf.protein_endPY], } # perform clustalw multiple alignment (alignedseqs, alignment) = clustalw(seqs=seqdict) # strip exterior gaps alignedseqs, alignment, coords = strip_alignment_for_exterior_gaps( deepcopy(alignedseqs), deepcopy(alignment), deepcopy(coords)) if alignedseqs['query_hmm'].count("-") > 0: # in (very) exceptional cases, gaps can be introduced in the # clustalw alignment in the HMM seq. This normally does not # occur! Fix this here by placing gaps in sbjctseq too. sbjctseq_as_list = list(sbjctseq) for pos in range(0, len(alignedseqs['query_hmm'])): if alignedseqs['query_hmm'][pos] == "-": sbjctseq_as_list.insert(pos, "-") if alignedseqs['query_hmm'].find("-", pos) == -1: break sbjctseq = "".join(sbjctseq_as_list) ######################################################################## if verbose: print "\t", "FALSE::", sbjctseq, "[ WITH GAPS,SBJCT ]" print "\t", "FALSE::", queryseq, "[ WITH GAPS ]" for k, algseq in alignedseqs.iteritems(): print "\t", "FALSE::", algseq, k, coords[k], len(algseq) print "\t", "FALSE::", sbjctseq, "SBJCT", len(sbjctseq) print "\t", "FALSE::", alignment, "ALMNT", len(alignment) print "\t", "SOLVED:", len( alignedseqs['query_orf']) == len(sbjctseq) ######################################################################## # update query sequence & coordinates if len(alignedseqs['query_orf']) == len(sbjctseq): queryseq = alignedseqs['query_orf'] query_aa_start = coords['query_orf'][0] query_aa_end = coords['query_orf'][1] else: # still not identical lengths. ClustalW recovery of HMM hit # failed miserably. For now: omit # TODO: resolve this case!! # example: --filewithloci examples/bilal/CFU_830450.bothss.csv # ## HMM clustalw input profile: False MAXSR True # FPKGCESGKFINWKTFKANGVNLGAWLAKEKTHDPVW foxga [561, 598] # FQRACR--KFID-ETLSAHAL---EWESKEIVPPEVW CFU [357, 388] # hmmhit2pacbp CREATING pacbps for organism/orf: (NP1064101[anid],1) # hmmhit2pacbp Q 'FQKACRSGKFIDWKTLKANALNLGEWLAKEKVHD' # hmmhit2pacbp m '+ ka + F W k + nLG Wl E d' # hmmhit2pacbp S 'YTKAFQ--PF-SWSSAKVRGANLGGWLVQEASID' # hmmQ: FQKACRSGKFIDWKTLKANALNLGEWLAKEKVHD 1 34 gaps: 0 34 # hmmM: + ka + F W k + nLG Wl E d # hmmS: YTKAFQ--PF-SWSSAKVRGANLGGWLVQEASID ('NP1064101[anid]', 1) 33 64 len: 31 34 # hmmq: FQKACRSGKFIDWKTLKANALNLGEWLAKEKVHD ('CFU', 91) 357 391 len: 34 34 # FALSE:: YTKAFQ---------PF-SWSS-----------------AKVR----------GANLGG--W-LVQEASID [ WITH GAPS,SBJCT ] # FALSE:: FQKACRSGKFIDWKTLKANALNLGEWLAKEKVHD [ WITH GAPS ] # FALSE:: FQKACR-------SGKFIDWKT-----------------LKAN----------ALNLGE--W-LAKEKVH query_hmm [0, 33] 70 # FALSE:: FQRACRKFIDETLSAHALEWESKEIVPPEVWQRFAEANMLIPNLAALASRMVGEIGIGNAFWRLSVQGLR query_orf [357, 427] 70 # FALSE:: YTKAFQ---------PF-SWSS-----------------AKVR----------GANLGG--W-LVQEASID SBJCT 71 # FALSE:: **:*** *.: ::*:: * .* :.:*: * *: : :: ALMNT 70 # SOLVED: False # Pacbp creation failed! return False, None if queryseq and sbjctseq: ################################################################ if len(queryseq) != len(sbjctseq): # this will result in a exception to be raised: # pacb.exceptions.InproperlyAppliedArgument # print data here about what went wrong, then # just let the error be raised print queryseq, len(queryseq), sbjctseq, len(sbjctseq) print hmmhit print "Q:", query_aa_start, query_aa_end, print query_aa_end - query_aa_start, "len:", len(queryseq) print "S:", sbjctaastart, sbjctaaend, print sbjctaaend - sbjctaastart, "len:", len(sbjctseq) ################################################################ pacbpinput = (queryseq, sbjctseq, query_aa_start, sbjctaastart) pacbp = PacbP(input=pacbpinput) # remove consistent internal gaps caused hy HMM profile search pacbp.strip_consistent_internal_gaps() pacbp.source = 'hmmsearch' pacbporf = PacbPORF(pacbp, queryorf, sbjctorf) pacbporf.strip_unmatched_ends() if pacbporf.length == 0: # Pacbp creation failed! return False, None else: pacbporf.extend_pacbporf_after_stops() pacbpkey = pacbporf.construct_unique_key(queryNode, sbjctNode) # return unique key and pacbporf return (pacbpkey, queryNode, sbjctNode), pacbporf else: # Pacbp creation failed! return False, None
def _merge_pacbporfs_by_tinyexon_and_two_introns(pacbporfD, pacbporfA, orfSetObject, queryorsbjct, verbose=False, **kwargs): """ Merge 2 PacbPORF objects by introns @attention: see pacb.connecting.merge_orfs_with_intron for **kwargs) @type pacbporfD: PacbPORF object @param pacbporfD: PacbPORF object that has to deliver PSSM donor objects @type pacbporfA: PacbPORF object @param pacbporfA: PacbPORF object that has to deliver PSSM acceptor objects @type orfSetObject: object with elegiable Orfs @param orfSetObject: object with elegiable Orfs @type queryorsbjct: string @param queryorsbjct: literal string 'query' or 'sbjct' @type verbose: Boolean @param verbose: print debugging info to STDOUT when True @rtype: list @return: list with ( intron, ExonOnOrf, intron ) on the query sequence """ # input validation IsPacbPORF(pacbporfD) IsPacbPORF(pacbporfA) # edit **kwargs dictionary for some forced attributes _update_kwargs(kwargs, KWARGS_PROJECTED_TINYEXON) MAX_TINYEXON_NT_LENGTH = 33 MIN_TINYEXON_NT_LENGTH = 6 tinyexons = [] if queryorsbjct == "query": donorOrf = pacbporfD.orfQ accepOrf = pacbporfA.orfQ prjctOrf = pacbporfD.orfS alignedDonorRange = pacbporfD.alignment_dna_range_query() alignedAccepRange = pacbporfA.alignment_dna_range_query() elif queryorsbjct == "sbjct": donorOrf = pacbporfD.orfS accepOrf = pacbporfA.orfS prjctOrf = pacbporfD.orfQ alignedDonorRange = pacbporfD.alignment_dna_range_sbjct() alignedAccepRange = pacbporfA.alignment_dna_range_sbjct() else: message = "'queryorsbjct' (%s), not 'query' or 'sbjct'" % queryorsbjct raise InproperlyAppliedArgument, message for dObj in donorOrf._donor_sites: # do not make a projection OVER the aligned area if dObj.pos < min(alignedDonorRange): continue if queryorsbjct == "query": (dPos, dPhase) = pacbporfD.dnaposition_query(dObj.pos, forced_return=True) else: (dPos, dPhase) = pacbporfD.dnaposition_sbjct(dObj.pos, forced_return=True) try: algDobj = pacbporfD._positions[dPos] except IndexError: # site out of range of PacbPORF -> break break for aObj in accepOrf._acceptor_sites: # do not make a projection OVER the aligned area if aObj.pos > max(alignedAccepRange): continue if queryorsbjct == "query": (aPos, aPhase) = pacbporfA.dnaposition_query(aObj.pos, forced_return=True) else: (aPos, aPhase) = pacbporfA.dnaposition_sbjct(aObj.pos, forced_return=True) try: algAobj = pacbporfA._positions[aPos] except IndexError: # site out of range of PacbPORF -> break break if queryorsbjct == "query": posDsbjct = algDobj.sbjct_dna_start + dPhase posAsbjct = algAobj.sbjct_dna_start + aPhase else: posDsbjct = algDobj.query_dna_start + dPhase posAsbjct = algAobj.query_dna_start + aPhase distance = posAsbjct - posDsbjct if distance >= MAX_TINYEXON_NT_LENGTH: break if distance < MIN_TINYEXON_NT_LENGTH: continue #################################################### # generate a ScanForMatches pattern file #################################################### # example pattern: 6...6 AG NNGNNANNANNGN[2,0,0] GT 3...3 query = list(prjctOrf.inputgenomicsequence[posDsbjct:posAsbjct]) # mask all non-phase0 nucleotides to N residues; # this represents the regularexpression for a specific # peptide sequence firstphasepositions = range(3 - dPhase % 3, len(query), 3) for pos in range(0, len(query)): if pos not in firstphasepositions: query[pos] = "N" # calculate a ~50% mismatch number mismatches = max([0, (len(query) - query.count("N")) / 2]) # write the pattern to string and subsequently to file # example pattern: 6...6 AG NNGNNANNANNGN[2,0,0] GT 3...3 if kwargs['allow_non_canonical_donor']: sfmpat = "%s...%s AG %s[%s,0,0] G (T | C) %s...%s" % ( AUSO, AUSO, "".join(query), mismatches, DDSO, DDSO) else: sfmpat = "%s...%s AG %s[%s,0,0] GT %s...%s" % ( AUSO, AUSO, "".join(query), mismatches, DDSO, DDSO) #################################################### if verbose: print(pacbporfD.orfQ.id, pacbporfA.orfQ.id), print distance, dObj, aObj print sfmpat #################################################### fname = "sfmpat_tinyexon_%s_%s_%s_%s" % ( donorOrf.id, accepOrf.id, posDsbjct, posAsbjct, ) fh = open(fname, 'w') fh.write(sfmpat + "\n") fh.close() #################################################### # run ScanForMatches #################################################### command = """echo ">myseq\n%s" | %s %s | tr "[,]" "\t\t#" | """ +\ """tr -d "\n " | sed "s/>/\\n>/g" | tr "#" "\t" | """ +\ """awk -F'\t' '{ if (NF==4 && $2>%s && $3<%s) """ +\ """{ print $1"["$2","$3"]\\n"$4 } }' """ command = command % (donorOrf.inputgenomicsequence, EXECUTABLE_SFM, fname, dObj.pos + (kwargs['min_intron_nt_length'] - 3), aObj.pos - (kwargs['min_intron_nt_length'] - 3)) co = osPopen(command) matches = parseFasta(co.readlines()) co.close() # filter matches for: # (1) correct donor & acceptor phase # (2) high enough donor & acceptor site scores for hdr, seqmatch in matches.iteritems(): startQ, stopQ = [ int(item) for item in hdr.split(":")[1][1:-1].split(",") ] exonQstart = startQ + AUSO + 2 - 1 exonQstop = stopQ - DDSO - 2 #################################### # get Orf object of tinyexon #################################### tinyexonorf = None # select the Orf on which the tinyexon is located for orfObj in orfSetObject.get_eligible_orfs( max_orf_start=exonQstart, min_orf_end=exonQstop): orfPhase = (exonQstart - orfObj.startPY) % 3 if orfPhase == dPhase: tinyexonorf = orfObj break else: # No tinyexonorf assigned!! Iin case a regex matched # over a STOP-codon or the regex length is smaller # then the smallest Orf, no Orf can be assigned continue # filter for donor & acceptor score dScore = _score_splice_site(seqmatch[-9:], splicetype='donor') aScore = _score_splice_site(seqmatch[0:11], splicetype='acceptor') if dScore < kwargs['min_donor_pssm_score']: continue if aScore < kwargs['min_acceptor_pssm_score']: continue # scan Orf for splicesites tinyexonorf.scan_orf_for_pssm_splice_sites( splicetype="donor", min_pssm_score=kwargs['min_donor_pssm_score'], allow_non_canonical=kwargs['allow_non_canonical_donor'], non_canonical_min_pssm_score=kwargs[ 'non_canonical_min_donor_pssm_score']) tinyexonorf.scan_orf_for_pssm_splice_sites( splicetype="acceptor", min_pssm_score=kwargs['min_acceptor_pssm_score'], allow_non_canonical=kwargs['allow_non_canonical_acceptor'], non_canonical_min_pssm_score=kwargs[ 'non_canonical_min_acceptor_pssm_score']) # get 1th intron donor object intron1_aObj = None for a in tinyexonorf._acceptor_sites: if a.pos == exonQstart: intron1_aObj = a break else: # pseudo-acceptorsite as found be SFM regex # is not a valid acceptor site of high enough score # continue to next iteration of (hdr,seqmatch) pair continue # get 2th intron donor object intron2_dObj = None for d in tinyexonorf._donor_sites: if d.pos == exonQstop: intron2_dObj = d break else: # pseudo-donorsite as found be SFM regex # is not a valid acceptor site of high enough score # continue to next iteration of (hdr,seqmatch) pair continue # check if introns are of elegiable lengths if (intron1_aObj.pos - dObj.pos) > kwargs['max_intron_nt_length']: continue if (aObj.pos - intron2_dObj.pos) > kwargs['max_intron_nt_length']: continue #################################################### if True or verbose: # if here, a candidate!!! print(pacbporfD.orfQ.id, tinyexonorf.id, pacbporfA.orfQ.id), print hdr, dScore, aScore print seqmatch #################################################### # append to found tinyexons query_data = (tinyexonorf, exonQstart, exonQstop) sbjct_data = (prjctOrf, posDsbjct, posAsbjct) splicesite_data = (dObj, intron1_aObj, intron2_dObj, aObj) tinyexons.append((query_data, sbjct_data, splicesite_data)) # file cleanup osRemove(fname) # return - End Of Function - if no tinyexons are found if not tinyexons: return [] #################################### # select the **best** tinyexon #################################### (query_data, sbjct_data, splicesite_data) = tinyexons[0] orfQ, query_dna_start, query_dna_end = query_data orfS, sbjct_dna_start, sbjct_dna_end = sbjct_data (intron1_dObj, intron1_aObj, intron2_dObj, intron2_aObj) = splicesite_data #################################################### if verbose: print "tinyexon orf:", orfQ print "tinyexon orf:", intron1_aObj print "tinyexon orf:", intron2_dObj #################################################### #################################### # make tinyexon PacbPORF #################################### startQaa = orfQ.dnapos2aapos(query_dna_start) - 1 startSaa = orfS.dnapos2aapos(sbjct_dna_start) - 1 stopQaa = orfQ.dnapos2aapos(query_dna_end) + 1 stopSaa = orfS.dnapos2aapos(sbjct_dna_end) + 1 # check for directly leading stop codon on tinyexon while startQaa <= orfQ.protein_startPY: startQaa += 1 startSaa += 1 query_dna_start += 3 sbjct_dna_start += 3 while startSaa <= orfS.protein_startPY: startQaa += 1 startSaa += 1 query_dna_start += 3 sbjct_dna_start += 3 # check for directly tailing stop codon on tinyexon while stopQaa > orfQ.protein_endPY: stopQaa -= 1 stopSaa -= 1 query_dna_end -= 3 sbjct_dna_end -= 3 while stopSaa > orfS.protein_endPY: stopQaa -= 1 stopSaa -= 1 query_dna_end -= 3 sbjct_dna_end -= 3 # get sequences qAAseq = orfQ.getaas(abs_pos_start=startQaa, abs_pos_end=stopQaa) sAAseq = orfS.getaas(abs_pos_start=startSaa, abs_pos_end=stopSaa) #################################################### if verbose or len(qAAseq) != len(sAAseq): # if unequal lengths, error will be raised upon PacbP.__init__() print orfQ, qAAseq, startQaa, stopQaa, (stopQaa - startQaa), print(query_dna_start, query_dna_end) print orfS, sAAseq, startSaa, stopSaa, (stopSaa - startSaa), print(sbjct_dna_start, sbjct_dna_end) print orfQ.inputgenomicsequence[query_dna_start - 2:query_dna_end + 2] print orfS.inputgenomicsequence[sbjct_dna_start - 2:sbjct_dna_end + 2] #################################################### # initialize extended tinyexon PacbPORF from pacb import PacbP pacbp = PacbP(input=(qAAseq, sAAseq, startQaa, startSaa)) pacbp.strip_unmatched_ends() pacbporf = pacbp2pacbporf(pacbp, orfQ, orfS) pacbporf.extend_pacbporf_after_stops() pacbporf.source = 'ABGPprojectingTE' #################################### # make introns #################################### intron1 = IntronConnectingOrfs(intron1_dObj, intron1_aObj, None, donorOrf, pacbporf.orfQ) intron2 = IntronConnectingOrfs(intron2_dObj, intron2_aObj, None, pacbporf.orfQ, accepOrf) ################################################################ # set some meta-data properties to the intron objects ################################################################ # add distance score to intron intron1._distance = 0 intron2._distance = 0 # add Alignment Positional Periphery Score into objects if queryorsbjct == "query": succes = set_apps_intron_query(intron1, pacbporfD, pacbporf) succes = set_apps_intron_query(intron2, pacbporf, pacbporfA) else: succes = set_apps_intron_sbjct(intron1, pacbporfD, pacbporf) succes = set_apps_intron_sbjct(intron2, pacbporf, pacbporfA) # set GFF fsource attribute for recognition of intron sources intron1._gff['fsource'] = "ABGPprojectingTE" intron2._gff['fsource'] = "ABGPprojectingTE" # create _linked_to_xxx attributes intron1._linked_to_pacbporfs = [pacbporf] intron2._linked_to_pacbporfs = [pacbporf] intron1._linked_to_introns = [intron2] intron2._linked_to_introns = [intron1] #################################################### if verbose: print pacbporf pacbporf.print_protein_and_dna() print intron1 print intron2 if False: # printing data when this function needs to be debugged: print "" print intron1 print intron2 print "" print pacbporfD pacbporfD.print_protein_and_dna() print "" print pacbporf pacbporf.print_protein_and_dna() print "" print pacbporfA pacbporfA.print_protein_and_dna() import sys sys.exit() #################################################### # return introns and intermediate tinyexon PacbPORF return [(intron1, intron2, pacbporf)]
def _merge_pacbporfs_by_two_tinyexons(pacbporfD, pacbporfA, orfSetObject, queryorsbjct, verbose=False, **kwargs): """ """ # edit **kwargs dictionary for some forced attributes _update_kwargs(kwargs, KWARGS_PROJECTED_TINYEXON) tinyexons = [] sposD = pacbporfD._get_original_alignment_pos_start() eposD = pacbporfD._get_original_alignment_pos_end() sposA = pacbporfA._get_original_alignment_pos_start() eposA = pacbporfA._get_original_alignment_pos_end() if queryorsbjct == "query": donorOrf = pacbporfD.orfQ accepOrf = pacbporfA.orfQ prjctOrf = pacbporfD.orfS dStart, dEnd = sposD.query_dna_start, eposD.query_dna_end aStart, aEnd = sposA.query_dna_start, eposA.query_dna_end elif queryorsbjct == "sbjct": donorOrf = pacbporfD.orfS accepOrf = pacbporfA.orfS prjctOrf = pacbporfD.orfQ dStart, dEnd = sposD.sbjct_dna_start, eposD.sbjct_dna_end aStart, aEnd = sposA.sbjct_dna_start, eposA.sbjct_dna_end else: message = "'queryorsbjct' (%s), not 'query' or 'sbjct'" % queryorsbjct raise InproperlyAppliedArgument, message # get all potential combinations of two tinyexons tinyexoncombis = merge_orfs_with_two_tinyexons( donorOrf, accepOrf, donorOrf._donor_sites, accepOrf._acceptor_sites, orfSetObject.orfs, ) results = [] for dObj in donorOrf._donor_sites: if queryorsbjct == "query": (dPos, dPhase) = pacbporfD.dnaposition_query(dObj.pos, forced_return=True) else: (dPos, dPhase) = pacbporfD.dnaposition_sbjct(dObj.pos, forced_return=True) try: algDobj = pacbporfD._positions[dPos] except IndexError: # site out of range of PacbPORF -> break break # check if dObj is on pfD; # introns of tinyexons can be projected outside of pfD/pfA area if dObj.pos < dStart: continue for aObj in accepOrf._acceptor_sites: if queryorsbjct == "query": (aPos, aPhase) = pacbporfA.dnaposition_query(aObj.pos, forced_return=True) else: (aPos, aPhase) = pacbporfA.dnaposition_sbjct(aObj.pos, forced_return=True) try: algAobj = pacbporfA._positions[aPos] except IndexError: # site out of range of PacbPORF -> break break # check if aObj is on pfA; # introns of tinyexons can be projected outside of pfD/pfA area if aObj.pos > aEnd: continue if queryorsbjct == "query": posDsbjct = algDobj.sbjct_dna_start + dPhase posAsbjct = algAobj.sbjct_dna_start + aPhase else: posDsbjct = algDobj.query_dna_start + dPhase posAsbjct = algAobj.query_dna_start + aPhase distance = posAsbjct - posDsbjct if distance >= (kwargs['max_tinyexon_nt_length'] * 2): break if distance < (kwargs['min_tinyexon_nt_length'] * 2): continue filtered_tinyexoncombis = _filter_tinyexoncombis( tinyexoncombis, min_length=distance, max_length=distance, min_first_acceptor_pos=dObj.pos + kwargs['min_tinyexon_intron_nt_length'], max_final_donor_pos=aObj.pos - kwargs['min_tinyexon_intron_nt_length'], phase_final_donor=aObj.phase, phase_first_acceptor=dObj.phase, ) if not filtered_tinyexoncombis: continue #################################################################### if verbose: print distance, dObj, aObj, len(tinyexoncombis), print len(filtered_tinyexoncombis) #################################################################### for exon1, intron, exon2 in filtered_tinyexoncombis: # make preceding intron preceding_intron = IntronConnectingOrfs( dObj, exon1.acceptor, None, donorOrf, exon1.orf) # make subsequent intron subsequent_intron = IntronConnectingOrfs( exon2.donor, aObj, None, exon2.orf, accepOrf) ################################################################ if verbose: print "\t", exon1, exon1.proteinsequence(), print preceding_intron.phase, exon1.donor.phase, print subsequent_intron.phase, preceding_intron.shared_aa, print intron.shared_aa, subsequent_intron.shared_aa print "\t", exon2, exon2.proteinsequence() ################################################################ # get prjctOrf sequence for comparison correctionA = 0 if aObj.phase != 0: # INCLUDE the final AA which is broken by the splicesite correctionA = 1 if queryorsbjct == "query": startPos, _phase = pacbporfD.dnaposition_query( dObj.pos, forced_return=True) stopPos, _phase = pacbporfA.dnaposition_query( aObj.pos, forced_return=True) start = pacbporfD._positions[startPos].sbjct_pos stop = pacbporfA._positions[stopPos].sbjct_pos + correctionA else: startPos, _phase = pacbporfD.dnaposition_sbjct( dObj.pos, forced_return=True) stopPos, _phase = pacbporfA.dnaposition_sbjct( aObj.pos, forced_return=True) start = pacbporfD._positions[startPos].query_pos stop = pacbporfA._positions[stopPos].query_pos + correctionA if stop <= start: # tinyexon is so tiny that is does not have a single # full aligned AA -> discard here continue # actually get the prjctOrf sequence aaseq = prjctOrf.getaas(abs_pos_start=start, abs_pos_end=stop) # initialize a PacbP for the combination of both tinyexons # afterwards, check if the indentityscore is > 0.XX from pacb import PacbP seqparts = [ preceding_intron.shared_aa, exon1.proteinsequence(), intron.shared_aa, exon2.proteinsequence(), subsequent_intron.shared_aa ] ################################################################ if verbose or len("".join(seqparts)) != len(aaseq): print pacbporfD print exon1.orf, exon2.orf, prjctOrf print pacbporfA print seqparts print aaseq, len(aaseq), len("".join(seqparts)), (start, stop) print "'%s'" % queryorsbjct, print "Q", (algDobj.query_pos, algAobj.query_pos), print "S", (algDobj.sbjct_pos, algAobj.sbjct_pos) print "distance:", distance, kwargs[ 'max_tinyexon_nt_length'], print(posDsbjct, posAsbjct), print "Q-dna:", (algDobj.query_dna_start, dPhase, algAobj.query_dna_start, aPhase), print "S-dna:", (algDobj.sbjct_dna_start, dPhase, algAobj.sbjct_dna_start, aPhase) ################################################################ # ignore by continue when sequences not identical in length if len("".join(seqparts)) != len(aaseq): continue testpacbp = PacbP(input=("".join(seqparts), aaseq, 0, 0)) testpacbp.strip_unmatched_ends() if not ( testpacbp.identityscore > 0.60 and\ (float(testpacbp.length) / len(aaseq)) > 0.70 ): # not a very convincing alignment continue ################################################################ if verbose: print testpacbp testpacbp.print_protein() ################################################################ # if here, succesfully mapped 2 tiny exons!! # get all sequences/coordinates in place for # pacbporf formation orfQ1 = exon1.orf orfS1 = prjctOrf orfQ2 = exon2.orf orfS2 = prjctOrf seqQ1 = exon1.proteinsequence() seqQ2 = exon2.proteinsequence() coordQ1 = exon1.acceptor.pos / 3 coordS1 = start coordQ2 = exon2.acceptor.pos / 3 coordS2 = start + len(seqparts[0]) + len(seqparts[1]) + len( seqparts[2]) seqS1 = aaseq[0:(len(seqparts[0]) + len(seqparts[1]))] seqS2 = aaseq[-(len(seqparts[3]) + len(seqparts[4])):] if len(seqparts[0]): seqS1 = seqS1[1:] coordS1 += 1 if len(seqparts[4]): seqS2 = seqS2[:-1] if queryorsbjct == "sbjct": # swap query <-> sbjct orfQ1, orfS1 = orfS1, orfQ1 orfQ2, orfS2 = orfS2, orfQ2 seqQ1, seqS1 = seqS1, seqQ1 seqQ2, seqS2 = seqS2, seqQ2 coordQ1, coordS1 = coordS1, coordQ1 coordQ2, coordS2 = coordS2, coordQ2 ################################################################ if verbose: print "tinypacbporf1:", seqQ1, seqQ2, coordQ1, coordQ2 print "tinypacbporf2:", seqS1, seqS2, coordS1, coordS2 ################################################################ # make pacbporfs pacbp1 = PacbP(input=(seqQ1, seqS1, coordQ1, coordS1)) pacbp1.strip_unmatched_ends() tinypacbporf1 = pacbp2pacbporf(pacbp1, orfQ1, orfS1) tinypacbporf1.extend_pacbporf_after_stops() pacbp2 = PacbP(input=(seqQ2, seqS2, coordQ2, coordS2)) pacbp2.strip_unmatched_ends() tinypacbporf2 = pacbp2pacbporf(pacbp2, orfQ2, orfS2) tinypacbporf2.extend_pacbporf_after_stops() ################################################################ if verbose: print tinypacbporf1 tinypacbporf1.print_protein_and_dna() print tinypacbporf2 tinypacbporf2.print_protein_and_dna() ################################################################ ################################################################ # set some meta-data properties to the intron objects ################################################################ # add distance score to intron preceding_intron._distance = 0 intron._distance = 0 subsequent_intron._distance = 0 # add Alignment Positional Periphery Score into objects if queryorsbjct == "query": succes = set_apps_intron_query(preceding_intron, pacbporfD, tinypacbporf1) succes = set_apps_intron_query(intron, tinypacbporf1, tinypacbporf2) succes = set_apps_intron_query(subsequent_intron, tinypacbporf2, pacbporfA) else: succes = set_apps_intron_sbjct(preceding_intron, pacbporfD, tinypacbporf1) succes = set_apps_intron_sbjct(intron, tinypacbporf1, tinypacbporf2) succes = set_apps_intron_sbjct(subsequent_intron, tinypacbporf2, pacbporfA) # set GFF fsource attribute for recognition of intron sources preceding_intron._gff['fsource'] = "ABGPprojectingTE" intron._gff['fsource'] = "ABGPprojectingTE" subsequent_intron._gff['fsource'] = "ABGPprojectingTE" # create _linked_to_xxx attributes preceding_intron._linked_to_pacbporfs = [ tinypacbporf1, tinypacbporf2 ] intron._linked_to_pacbporfs = [tinypacbporf1, tinypacbporf2] subsequent_intron._linked_to_pacbporfs = [ tinypacbporf1, tinypacbporf2 ] preceding_intron._linked_to_introns = [ intron, subsequent_intron ] intron._linked_to_introns = [ preceding_intron, subsequent_intron ] subsequent_intron._linked_to_introns = [ intron, preceding_intron ] ################################################################ # append to results ################################################################ results.append(( preceding_intron, intron, subsequent_intron, tinypacbporf1, tinypacbporf2, )) # return 3 introns and 2 intermediate tinyexon PacbPORFs (per row) return results
def merge_pacbporfs_by_tinyexons(pacbporfD, pacbporfA, orfSetObjQ, orfSetObjS, verbose=False, **kwargs): """ """ # input validation IsPacbPORF(pacbporfD) IsPacbPORF(pacbporfA) # edit **kwargs dictionary for some forced attributes _update_kwargs(kwargs, KWARGS_MAPPED_INTRON) if not kwargs.has_key('aligned_site_max_triplet_distance'): kwargs['aligned_site_max_triplet_distance'] = kwargs['max_aa_offset'] # settings for minimal alignment entropy score min_donor_site_alignment_entropy = 0.0 min_acceptor_site_alignment_entropy = 0.0 resultlistQ = merge_orfs_with_tinyexon( pacbporfD.orfQ, pacbporfA.orfQ, preceding_donor_sites=pacbporfD.orfQ._donor_sites, subsequent_acceptor_sites=pacbporfA.orfQ._acceptor_sites, orflist=orfSetObjQ.orfs, **kwargs) resultlistS = merge_orfs_with_tinyexon( pacbporfD.orfS, pacbporfA.orfS, preceding_donor_sites=pacbporfD.orfS._donor_sites, subsequent_acceptor_sites=pacbporfA.orfS._acceptor_sites, orflist=orfSetObjS.orfs, **kwargs) # translate resultlists to dict: key == exon, value = [ {intronsD},{intronsS} ] resultdictQ, key2exonQ = _tinyexon_list_2_dict(resultlistQ) resultdictS, key2exonS = _tinyexon_list_2_dict(resultlistS) # get unique list of donors & acceptors donorQ = olba(list(Set([inD.donor for inD, te, inA in resultlistQ])), order_by='pos') donorS = olba(list(Set([inD.donor for inD, te, inA in resultlistS])), order_by='pos') accepQ = olba(list(Set([inA.acceptor for inD, te, inA in resultlistQ])), order_by='pos') accepS = olba(list(Set([inA.acceptor for inD, te, inA in resultlistS])), order_by='pos') ## filter for alignable donor & acceptor sites kwargs['allow_non_canonical'] = True # True kwargs['aligned_site_max_triplet_distance'] = 0 # 2 algdonors = _filter_for_alignable_splice_sites(donorQ, donorS, pacbporfD, **kwargs) algacceps = _filter_for_alignable_splice_sites(accepQ, accepS, pacbporfA, **kwargs) # settings for minimal alignment entropy score # TODO TODO -> THIS MUST BE FIXED TO A NICE THRESHOLD VALUE!!! min_donor_site_alignment_entropy = 0.1 min_acceptor_site_alignment_entropy = 0.1 # remove sites with to low alignment entropy algdonors = _filter_for_entropy( algdonors, pacbporfD, 'donor', min_alignment_entropy=min_donor_site_alignment_entropy) algacceps = _filter_for_entropy( algacceps, pacbporfA, 'acceptor', min_alignment_entropy=min_acceptor_site_alignment_entropy) # return list: intronQD,intronSD,tinyexon,intronAQ,intronAS return_list = [] ############################################################################ if verbose: print "bridges constructed: ORFS:", print(pacbporfD.orfQ.id, pacbporfA.orfQ.id), print(pacbporfD.orfS.id, pacbporfA.orfS.id), print len(resultdictQ), len(resultdictS), print(len(resultlistQ), len(donorQ), len(accepQ)), print(len(resultlistS), len(donorS), len(accepS)), print(len(algdonors), len(algacceps)) ############################################################################ for keyQ, tinyexonQ in key2exonQ.iteritems(): for keyS, tinyexonS in key2exonS.iteritems(): if tinyexonQ.donor.phase != tinyexonS.donor.phase: continue if tinyexonQ.acceptor.phase != tinyexonS.acceptor.phase: continue if tinyexonQ.length != tinyexonS.length: continue # if here, then tinyexons of identical structure #################################################################### if verbose: print tinyexonQ.length, tinyexonQ.donor.phase, print(len(resultdictQ[keyQ][0]), len(resultdictQ[keyQ][1])), print(len(resultdictS[keyS][0]), len(resultdictS[keyS][1])), print tinyexonQ, print tinyexonQ.proteinsequence(), tinyexonS.proteinsequence(), print tinyexonS.acceptor.pssm_score + tinyexonS.donor.pssm_score #################################################################### donor_introns = [] acceptor_introns = [] for intronDQkey, intronDQ in resultdictQ[keyQ][0].iteritems(): if intronDQ.donor.pos not in [dQ.pos for dQ, dS in algdonors]: continue for intronDSkey, intronDS in resultdictS[keyS][0].iteritems(): if intronDS.donor.pos not in [ dS.pos for dQ, dS in algdonors ]: continue # check if they exists as aligned sites alignedkey = (intronDQ.donor.pos, intronDS.donor.pos) if alignedkey not in [(dQ.pos, dS.pos) for dQ, dS in algdonors]: continue # if here, we have a set of introns 5' of the tinyexon # which are perfectly alignable! donor_introns.append((intronDQ, intronDS)) for intronAQkey, intronAQ in resultdictQ[keyQ][1].iteritems(): if intronAQ.acceptor.pos not in [ aQ.pos for aQ, aS in algacceps ]: continue for intronASkey, intronAS in resultdictS[keyS][1].iteritems(): if intronAS.acceptor.pos not in [ aS.pos for aQ, aS in algacceps ]: continue # check if they exists as aligned sites alignedkey = (intronAQ.acceptor.pos, intronAS.acceptor.pos) if alignedkey not in [(aQ.pos, aS.pos) for aQ, aS in algacceps]: continue # if here, we have a set of introns 3' of the tinyexon # which are perfectly alignable! acceptor_introns.append((intronAQ, intronAS)) if not len(donor_introns) or not len(acceptor_introns): # no aligned 5' && aligned 3' introns continue # initialize extended tinyexon PacbPORF from pacb import PacbP pacbp = PacbP(input=( tinyexonQ.proteinsequence(), tinyexonS.proteinsequence(), tinyexonQ.protein_start(), tinyexonS.protein_start(), )) pacbp.strip_unmatched_ends() # continue if no fraction could be aligned if len(pacbp) == 0: continue tinypacbporf = pacbp2pacbporf(pacbp, tinyexonQ.orf, tinyexonS.orf) tinypacbporf.extend_pacbporf_after_stops() #################################################################### if verbose: print tinypacbporf tinypacbporf.print_protein_and_dna() print len(donor_introns), len(acceptor_introns), print max([ dQ.donor.pssm_score + dS.donor.pssm_score for dQ, dS in donor_introns ]), print max([ aQ.acceptor.pssm_score + aS.acceptor.pssm_score for aQ, aS in acceptor_introns ]) #################################################################### # if here, we have accepted tinyexon bridges! # gather them and store to return_list for intronDQkey, intronDQ in resultdictQ[keyQ][0].iteritems(): if intronDQ.donor.pos not in [dQ.pos for dQ, dS in algdonors]: continue for intronDSkey, intronDS in resultdictS[keyS][0].iteritems(): if intronDS.donor.pos not in [ dS.pos for dQ, dS in algdonors ]: continue for intronAQkey, intronAQ in resultdictQ[keyQ][ 1].iteritems(): if intronAQ.acceptor.pos not in [ aQ.pos for aQ, aS in algacceps ]: continue for intronASkey, intronAS in resultdictS[keyS][ 1].iteritems(): if intronAS.acceptor.pos not in [ aS.pos for aQ, aS in algacceps ]: continue #################################################### # set some meta-data properties to the intron objects #################################################### _score_introns_obtained_by_mapping( intronDQ, intronDS, pacbporfD, tinypacbporf, source='ABGPmappingTE') _score_introns_obtained_by_mapping( intronAQ, intronAS, tinypacbporf, pacbporfA, source='ABGPmappingTE') # create _linked_to_xxx attributes intronDQ._linked_to_pacbporfs = [tinypacbporf] intronAQ._linked_to_pacbporfs = [tinypacbporf] intronDS._linked_to_pacbporfs = [tinypacbporf] intronAS._linked_to_pacbporfs = [tinypacbporf] intronDQ._linked_to_introns = [intronAQ] intronAQ._linked_to_introns = [intronDQ] intronDS._linked_to_introns = [intronAS] intronAS._linked_to_introns = [intronDS] # append to tmp result list return_list.append( (intronDQ, intronDS, tinypacbporf, intronAQ, intronAS)) # check if there are >1 candidate tiny exons # currently, we choose only to return the **best** mapped tinyexon if len(return_list) == 0: pass elif len(return_list) == 1: pass else: # only take the highest scoring candidate here min_distance = min([(a._distance + d._distance) for a, b, c, d, e in return_list]) pos2score = [] for (intronDQ, intronDS, tinypacbporf, intronAQ, intronAS) in return_list: if (intronDQ._distance + intronAQ._distance) > min_distance: pos2score.append(0.0) else: # calculate overall pssm score total_pssm = 0.0 total_pssm += intronDQ.donor.pssm_score total_pssm += intronDQ.acceptor.pssm_score total_pssm += intronDS.donor.pssm_score total_pssm += intronDS.acceptor.pssm_score total_pssm += intronAQ.donor.pssm_score total_pssm += intronAQ.acceptor.pssm_score total_pssm += intronAS.donor.pssm_score total_pssm += intronAS.acceptor.pssm_score pos2score.append(total_pssm) # get highest score and linked tinyexon max_score = max(pos2score) return_list = [return_list[pos2score.index(max_score)]] ############################################################################ # some printing in verbose mode if verbose and return_list: (intronDQ, intronDS, tinypacbporf, intronAQ, intronAS) = return_list[0] print "BEST MAPPED TINYEXON:" print tinypacbporf print tinypacbporf.query, intronDQ._distance, intronAQ._distance, print(intronDQ.donor.pos, intronDQ.acceptor.pos), print(intronDS.donor.pos, intronDS.acceptor.pos), print(intronAQ.donor.pos, intronAQ.acceptor.pos), print(intronAS.donor.pos, intronAS.acceptor.pos) ############################################################################ # return the result list return return_list