def test_read_2(self): content = """PFRMAT RR TARGET R9999 AUTHOR 1234-5678-9000 REMARK Predictor remarks METHOD Description of methods used MODEL 1 1 9 0 8 0.70 1 10 0 8 0.70 1 12 0 8 0.60 2 8 0 8 0.90 3 7 0 8 0.70 3 12 0 8 0.40 4 6 0 8 0.90 7 14 0 8 0.30 9 14 0 8 0.50 END """ f_name = self.tempfile(content=content) with open(f_name, "r") as f_in: contact_file = CaspParser().read(f_in) contact_map1 = contact_file.top_map self.assertEqual(1, len(contact_file)) self.assertEqual(9, len(contact_map1)) self.assertIsNone(contact_map1.sequence) with self.assertRaises(TypeError): _ = contact_map1.repr_sequence
def test_write_5(self): contact_file = ContactFile("RR") contact_map = ContactMap("1") contact_file.add(contact_map) for c in [(1, 9, 0, 8, 1.5), (1, 10, 0, 8, -0.3), (2, 8, 0, 8, 0.9), (3, 12, 0, 8, 0.4)]: contact = Contact(c[0], c[1], c[4], distance_bound=(c[2], c[3])) contact_map.add(contact) contact_map.sequence = Sequence( "1", "HLEGSIGILLKKHEIVFDGCHDFGRTYIWQMSDHLEGSIGILLKKHEIVFDGCHDFGRTYIWQMSD" ) f_name = self.tempfile() with open(f_name, "w") as f_out: CaspParser().write(f_out, contact_file) content = [ "PFRMAT RR", "MODEL 1", "HLEGSIGILLKKHEIVFDGCHDFGRTYIWQMSDHLEGSIGILLKKHEIVF", "DGCHDFGRTYIWQMSD", "1 9 0 8 1.000000", "1 10 0 8 0.000000", "2 8 0 8 0.666667", "3 12 0 8 0.388889", "ENDMDL", "END", ] with open(f_name, "r") as f_in: output = f_in.read().splitlines() self.assertEqual(content, output)
def test_read_6(self): content = """1 9 0 8 0.70 1 10 0 8 0.70 1 12 0 8 0.60 2 8 0 8 0.90 3 7 0 8 0.70 3 12 0 8 0.40 4 6 0 8 0.90 7 14 0 8 0.30 9 14 0 8 0.50 """ f_name = self.tempfile(content=content) parser = CaspParser() with open(f_name, "r") as f_in: with self.assertRaises(ValueError): CaspParser().read(f_in)
def test_write_6(self): contact_file = ContactFile('RR') contact_map = ContactMap('1') contact_file.add(contact_map) for c in [('A', 1, 'B', 9, 0, 8, 0.7), ('A', 1, 'B', 10, 0, 8, 0.7), ('A', 2, 'B', 8, 0, 8, 0.9), ('A', 3, 'B', 12, 0, 8, 0.4)]: contact = Contact(c[1], c[3], c[6], distance_bound=(c[4], c[5])) contact.res1_chain = c[0] contact.res2_chain = c[2] contact_map.add(contact) contact_map.sequence = Sequence( '1', 'HLEGSIGILLKKHEIVFDGCHDFGRTYIWQMSDHLEGSIGILLKKHEIVFDGCHDFGRTYIWQMSD' ) f_name = create_tmp_f() with open(f_name, 'w') as f_out: CaspParser().write(f_out, contact_file) content = [ "PFRMAT RR", "MODEL 1", "HLEGSIGILLKKHEIVFDGCHDFGRTYIWQMSDHLEGSIGILLKKHEIVF", "DGCHDFGRTYIWQMSD", "A1 B9 0 8 0.700000", "A1 B10 0 8 0.700000", "A2 B8 0 8 0.900000", "A3 B12 0 8 0.400000", "ENDMDL", "END", ] with open(f_name, 'r') as f_in: output = f_in.read().splitlines() self.assertEqual(content, output) os.unlink(f_name)
def test_read_1(self): content = """PFRMAT RR TARGET R9999 AUTHOR 1234-5678-9000 REMARK Predictor remarks METHOD Description of methods used METHOD Description of methods used MODEL 1 HLEGSIGILLKKHEIVFDGC HDFGRTYIWQMSD 1 9 0 8 0.70 1 10 0 8 0.70 1 12 0 8 0.60 2 8 0 8 0.90 3 7 0 8 0.70 3 12 0 8 0.40 4 6 0 8 0.90 7 14 0 8 0.30 9 14 0 8 0.50 END """ f_name = self.tempfile(content=content) with open(f_name, "r") as f_in: contact_file = CaspParser().read(f_in) contact_map1 = contact_file.top_map self.assertEqual(1, len(contact_file)) self.assertEqual(9, len(contact_map1)) self.assertEqual("HLEGSIGILLKKHEIVFDGCHDFGRTYIWQMSD", contact_map1.sequence.seq) self.assertEqual("HLEG-IGILL-K-E-------------------", contact_map1.repr_sequence.seq)
def test_write_5(self): contact_file = ContactFile('RR') contact_map = ContactMap('1') contact_file.add(contact_map) for c in [(1, 9, 0, 8, 1.5), (1, 10, 0, 8, -0.3), (2, 8, 0, 8, 0.9), (3, 12, 0, 8, 0.4)]: contact = Contact(c[0], c[1], c[4], distance_bound=(c[2], c[3])) contact_map.add(contact) contact_map.sequence = Sequence( '1', 'HLEGSIGILLKKHEIVFDGCHDFGRTYIWQMSDHLEGSIGILLKKHEIVFDGCHDFGRTYIWQMSD' ) f_name = create_tmp_f() with open(f_name, 'w') as f_out: CaspParser().write(f_out, contact_file) content = [ "PFRMAT RR", "MODEL 1", "HLEGSIGILLKKHEIVFDGCHDFGRTYIWQMSDHLEGSIGILLKKHEIVF", "DGCHDFGRTYIWQMSD", "1 9 0 8 1.000000", "1 10 0 8 0.000000", "2 8 0 8 0.666667", "3 12 0 8 0.388889", "ENDMDL", "END", "", ] content = os.linesep.join(content) with open(f_name, 'r') as f_in: data = "".join(f_in.readlines()) self.assertEqual(content, data) os.unlink(f_name)
def test_write_3(self): contact_file = ContactFile('RR') contact_map = ContactMap('1') contact_file.add(contact_map) for c in [(1, 9, 0, 8, 0.7), (1, 10, 0, 8, 0.7), (2, 8, 0, 8, 0.9), (3, 12, 0, 8, 0.4)]: contact = Contact(c[0], c[1], c[4], distance_bound=(c[2], c[3])) contact_map.add(contact) f_name = create_tmp_f() with open(f_name, 'w') as f_out: CaspParser().write(f_out, contact_file) content = [ "PFRMAT RR", "MODEL 1", "1 9 0 8 0.700000", "1 10 0 8 0.700000", "2 8 0 8 0.900000", "3 12 0 8 0.400000", "ENDMDL", "END", ] with open(f_name, 'r') as f_in: output = f_in.read().splitlines() self.assertEqual(content, output) os.unlink(f_name)
def test_read_6(self): content = """1 9 0 8 0.70 1 10 0 8 0.70 1 12 0 8 0.60 2 8 0 8 0.90 3 7 0 8 0.70 3 12 0 8 0.40 4 6 0 8 0.90 7 14 0 8 0.30 9 14 0 8 0.50 """ f_name = create_tmp_f(content=content) parser = CaspParser() with open(f_name, 'r') as f_in: with self.assertRaises(ValueError): CaspParser().read(f_in) os.unlink(f_name)
def test_read_4(self): content = """PFRMAT RR TARGET R9999 AUTHOR 1234-5678-9000 REMARK Predictor remarks METHOD Description of methods used METHOD Description of methods used MODEL 1 HLEGSIGILLKKHEIVFDGC HDFGRTYIWQMSD 1 9 0 8 0.70 1 10 0 8 0.70 1 12 0 8 0.60 2 8 0 8 0.90 3 7 0 8 0.70 3 12 0 8 0.40 4 6 0 8 0.90 7 14 0 8 0.30 9 14 0 8 0.50 ENDMDL MODEL 2 HLEGSIGILLKKHEIVFDGC HDFGRTYIWQM 1 10 0 8 0.70 1 12 0 8 0.60 2 8 0 8 0.90 3 7 0 8 0.70 3 12 0 8 0.40 4 6 0 8 0.90 7 14 0 8 0.30 9 14 0 8 0.50 ENDMDL END """ f_name = create_tmp_f(content=content) with open(f_name, 'r') as f_in: contact_file = CaspParser().read(f_in) self.assertEqual(2, len(contact_file)) contact_map1 = contact_file[0] self.assertEqual(9, len(contact_map1)) self.assertEqual("HLEGSIGILLKKHEIVFDGCHDFGRTYIWQMSD", contact_map1.sequence.seq) self.assertEqual("HLEG-IGILL-K-E-------------------", contact_map1.repr_sequence.seq) contact_map2 = contact_file['2'] self.assertEqual(8, len(contact_map2)) self.assertEqual("HLEGSIGILLKKHEIVFDGCHDFGRTYIWQM", contact_map2.sequence.seq) self.assertEqual("HLEG-IGILL-K-E-----------------", contact_map2.repr_sequence.seq) os.unlink(f_name)
def test_read_5(self): content = """PFRMAT RR TARGET R9999 MODEL 1 1 9 0 8 0.70 1 10 0 8 0.70 1 12 0 8 0.60 2 8 0 8 0.90 3 7 0 8 0.70 3 12 0 8 0.40 4 6 0 8 0.90 7 14 0 8 0.30 9 14 0 8 0.50 ENDMDL MODEL 2 HLEGSIGILLKKHEIVFDGC HDFGRTYIWQMSD 1 9 0 8 0.70 1 10 0 8 0.70 1 12 0 8 0.60 2 8 0 8 0.90 3 7 0 8 0.70 3 12 0 8 0.40 4 6 0 8 0.90 7 14 0 8 0.30 9 14 0 8 0.50 END """ f_name = create_tmp_f(content=content) with open(f_name, 'r') as f_in: contact_file = CaspParser().read(f_in) self.assertEqual(2, len(contact_file)) contact_map1 = contact_file["1"] self.assertEqual(9, len(contact_map1)) self.assertIsNone(contact_map1.sequence) contact_map2 = contact_file["2"] self.assertEqual(9, len(contact_map2)) self.assertEqual("HLEGSIGILLKKHEIVFDGCHDFGRTYIWQMSD", contact_map2.sequence.seq) self.assertEqual("HLEG-IGILL-K-E-------------------", contact_map2.repr_sequence.seq) os.unlink(f_name)
def test_write_1(self): contact_file = ContactFile('RR') contact_file.target = 'R9999' contact_file.author = '1234-5678-9000' contact_file.remark = ['Predictor remarks'] contact_file.method = [ 'Description of methods used', 'Description of methods used' ] contact_map = ContactMap('1') contact_file.add(contact_map) for c in [(1, 9, 0, 8, 0.7), (1, 10, 0, 8, 0.7), (2, 8, 0, 8, 0.9), (3, 12, 0, 8, 0.4)]: contact = Contact(c[0], c[1], c[4], distance_bound=(c[2], c[3])) contact_map.add(contact) contact_map.sequence = Sequence('1', 'HLEGSIGILLKKHEIVFDGCHDFGRTYIWQMSD') contact_map.assign_sequence_register() f_name = create_tmp_f() with open(f_name, 'w') as f_out: CaspParser().write(f_out, contact_file) content = [ "PFRMAT RR", "TARGET R9999", "AUTHOR 1234-5678-9000", "REMARK Predictor remarks", "METHOD Description of methods used", "METHOD Description of methods used", "MODEL 1", "HLEGSIGILLKKHEIVFDGCHDFGRTYIWQMSD", "1 9 0 8 0.700000", "1 10 0 8 0.700000", "2 8 0 8 0.900000", "3 12 0 8 0.400000", "ENDMDL", "END", "", ] content = os.linesep.join(content) with open(f_name, 'r') as f_in: data = "".join(f_in.readlines()) self.assertEqual(content, data) os.unlink(f_name)
def test_write_1(self): contact_file = ContactFile("RR") contact_file.target = "R9999" contact_file.author = "1234-5678-9000" contact_file.remark = ["Predictor remarks"] contact_file.method = [ "Description of methods used", "Description of methods used" ] contact_map = ContactMap("1") contact_file.add(contact_map) for c in [(1, 9, 0, 8, 0.7), (1, 10, 0, 8, 0.7), (2, 8, 0, 8, 0.9), (3, 12, 0, 8, 0.4)]: contact = Contact(c[0], c[1], c[4], distance_bound=(c[2], c[3])) contact_map.add(contact) contact_map.sequence = Sequence("1", "HLEGSIGILLKKHEIVFDGCHDFGRTYIWQMSD") contact_map.set_sequence_register() f_name = self.tempfile() with open(f_name, "w") as f_out: CaspParser().write(f_out, contact_file) content = [ "PFRMAT RR", "TARGET R9999", "AUTHOR 1234-5678-9000", "REMARK Predictor remarks", "METHOD Description of methods used", "METHOD Description of methods used", "MODEL 1", "HLEGSIGILLKKHEIVFDGCHDFGRTYIWQMSD", "1 9 0 8 0.700000", "1 10 0 8 0.700000", "2 8 0 8 0.900000", "3 12 0 8 0.400000", "ENDMDL", "END", ] with open(f_name, "r") as f_in: output = f_in.read().splitlines() self.assertEqual(content, output)
def test_read_7(self): content = """PFRMAT RR TARGET R9999 AUTHOR 1234-5678-9000 REMARK Predictor remarks METHOD Description of methods used METHOD Description of methods used MODEL 1 HLEGSIGILLKKHEIVFDGC HDFGRTYIWQMSD A1 B9 0 8 0.70 A1 B10 0 8 0.70 A1 B12 0 8 0.60 A1 B14 0 8 0.20 A1 B15 0 8 0.10 A1 B17 0 8 0.30 A1 B19 0 8 0.50 A2 B8 0 8 0.90 A3 B7 0 8 0.70 A3 B12 0 8 0.40 A3 B14 0 8 0.70 A3 B15 0 8 0.30 A4 B6 0 8 0.90 A7 B14 0 8 0.30 A9 B14 0 8 0.50 END """ f_name = create_tmp_f(content=content) with open(f_name, 'r') as f_in: contact_file = CaspParser().read(f_in) contact_map1 = contact_file.top_map self.assertEqual(1, len(contact_file)) self.assertEqual(15, len(contact_map1)) self.assertEqual("HLEGSIGILLKKHEIVFDGCHDFGRTYIWQMSD", contact_map1.sequence.seq) self.assertEqual("HLEG-IGILL-K-E-------------------", contact_map1.repr_sequence.seq) os.unlink(f_name)
def test_read_3(self): content = """PFRMAT RR MODEL 1 1 9 0 8 0.70 1 10 0 8 0.70 1 12 0 8 0.60 2 8 0 8 0.90 3 7 0 8 0.70 3 12 0 8 0.40 4 6 0 8 0.90 7 14 0 8 0.30 9 14 0 8 0.50 END """ f_name = self.tempfile(content=content) with open(f_name, "r") as f_in: contact_file = CaspParser().read(f_in) contact_map1 = contact_file.top_map self.assertEqual(1, len(contact_file)) self.assertEqual(9, len(contact_map1)) self.assertIsNone(contact_map1.sequence) with self.assertRaises(TypeError): _ = contact_map1.repr_sequence
def test_write_6(self): contact_file = ContactFile("RR") contact_map = ContactMap("1") contact_file.add(contact_map) for c in [ ("A", 1, "B", 9, 0, 8, 0.7), ("A", 1, "B", 10, 0, 8, 0.7), ("A", 2, "B", 8, 0, 8, 0.9), ("A", 3, "B", 12, 0, 8, 0.4), ]: contact = Contact(c[1], c[3], c[6], distance_bound=(c[4], c[5])) contact.res1_chain = c[0] contact.res2_chain = c[2] contact_map.add(contact) contact_map.sequence = Sequence( "1", "HLEGSIGILLKKHEIVFDGCHDFGRTYIWQMSDHLEGSIGILLKKHEIVFDGCHDFGRTYIWQMSD" ) f_name = self.tempfile() with open(f_name, "w") as f_out: CaspParser().write(f_out, contact_file) content = [ "PFRMAT RR", "MODEL 1", "HLEGSIGILLKKHEIVFDGCHDFGRTYIWQMSDHLEGSIGILLKKHEIVF", "DGCHDFGRTYIWQMSD", "A1 B9 0 8 0.700000", "A1 B10 0 8 0.700000", "A2 B8 0 8 0.900000", "A3 B12 0 8 0.400000", "ENDMDL", "END", ] with open(f_name, "r") as f_in: output = f_in.read().splitlines() self.assertEqual(content, output)