def write_backbone_angles(chain,
region=None,
offset=0,
outfile=sys.stdout,
header=False):
"""
Write Psi/Phi angles from a pdb file
"""
if region is None:
region = (0, float('inf'))
polypeptide_builder = PPBuilder()
polypeptides = polypeptide_builder.build_peptides(chain)
if header:
print(HEADER, file=outfile)
for peptide in polypeptides:
angles = peptide.get_phi_psi_list()
for residue, (phi, psi) in zip(peptide, angles):
position = residue.get_id()[1]
if region[0] <= position <= region[1]:
print(chain.id,
position,
seq1(residue.get_resname()),
position + offset,
'NA' if phi is None else phi * RAD_FACTOR,
'NA' if psi is None else psi * RAD_FACTOR,
sep='\t',
file=outfile)
def SplitChain(PDB_objects):
"""
Splits a list of PDB files by chain creating one PDB and one FASTA file per chain.
Arguments:
PDB_objects: list of PDB objects (with many chains) generated by the PDB parser.
"""
File_prefix = []
for pdb in PDB_objects:
chain_names = set()
io = PDBIO()
# Creates a PDB file for each chain of the original file.
for chain in pdb.get_chains():
if chain.get_id() not in chain_names:
io.set_structure(chain)
io.save(pdb.get_id() + "_" + chain.get_id() + ".pdb")
File_prefix.append(pdb.get_id() + "_" + chain.get_id())
# Creates a FASTA file for each chain of the original file.
polipeptide = PPBuilder()
for pp in polipeptide.build_peptides(pdb):
fasta = open(pdb.get_id() + "_" + chain.get_id() + ".fa",
"w")
fasta.write(">" + pdb.get_id() + "_" + chain.get_id() +
"\n")
fasta.write(str(pp.get_sequence()))
chain_names.add(chain.get_id())
return File_prefix
def CreateJoinedFastas(input_PDB_objects):
"""
Joins many PDB objects and creates a FASTA file with all objects joined.
Arguments:
input_PDB_objects: list of PDB objects whose sequence will be added to the FASTA file.
"""
polipeptide = PPBuilder()
first_line = True
filename = ""
# Create FASTA files.
for obj in input_PDB_objects:
filename = filename + obj.get_id() + "_"
filename = filename + ".fa"
joined_fasta = open(filename, 'w')
# Write FASTA files.
for obj in input_PDB_objects:
if first_line:
joined_fasta.write(">" + obj.get_id() + "\n")
first_line = False
else:
joined_fasta.write("\n" + ">" + obj.get_id() + "\n")
for polipep in polipeptide.build_peptides(obj):
joined_fasta.write(str(polipep.get_sequence()))
return filename
def compute_secondary_structure(self, model):
"""
This function defines all the secondary structures of the model passed in input
:param model: one model
:return: the matrix of secondary structures
"""
# Calculate PSI and PHI
ppb = PPBuilder()
rama = {
} # { chain : [[residue_1, ...], [phi_residue_1, ...], [psi_residue_2, ...] ] }
residue_found = 0
for chain in model:
for pp in ppb.build_peptides(chain):
phi_psi = pp.get_phi_psi_list()
for i, residue in enumerate(pp):
if phi_psi[i][0] is not None and phi_psi[i][1] is not None:
# Conversion to degrees when the values are not None (for first and last)
rama.setdefault(chain.id, [[], [], []])
rama[chain.id][0].append(residue)
rama[chain.id][1].append(math.degrees(phi_psi[i][0]))
rama[chain.id][2].append(math.degrees(phi_psi[i][1]))
else:
# Adding of Nan if the angles are None (for first and last)
rama.setdefault(chain.id, [[], [], []])
rama[chain.id][0].append(residue)
rama[chain.id][1].append(math.nan)
rama[chain.id][2].append(math.nan)
residue_found += 1
# Eventual nan-padding if something goes wrong during the angle computation
if residue_found < self._residues:
for i in range(self._residues - residue_found):
rama.setdefault('Z', [[], [], []])
rama['Z'][0].append(None)
rama['Z'][1].append(math.nan)
rama['Z'][2].append(math.nan)
# Comparison of the angles with the Ramachandran regions
ss = []
for chain_id in rama:
for residue, phi, psi in zip(*rama[chain_id]):
ss_class = None
if math.isnan(phi) and math.isnan(psi):
# If nan (angles not available) insert a symbol indicating this situation
ss_class = '-'
else:
# Determine the correspondent region and store it
for x, y, width, height, ss_c, color in self._ranges:
if x <= phi < x + width and y <= psi < y + height:
ss_class = ss_c
break
ss.append(ss_class)
return ss
def get_secondary_structure(structure):
rama_ss_ranges = [(-180, -180, 80, 60, 'E', 'blue'),
(-180, 50, 80, 130, 'E', 'blue'),
(-100, -180, 100, 60, 'P', 'green'),
(-100, 50, 100, 130, 'P', 'green'),
(-180, -120, 180, 170, 'H', 'red'),
(0, -180, 180, 360, 'L', 'yellow')]
# Calculate PSI and PHI
ppb = PPBuilder() # PolyPeptideBuilder
ss = ["" for x in range(N)]
for chain in structure:
for pp in ppb.build_peptides(chain):
phi_psi = pp.get_phi_psi_list(
) # [(phi_residue_1, psi_residue_1), ...]
for i, residue in enumerate(pp):
# print(model, chain, i, residue, phi_psi[i])
# Convert radians to degrees and remove first and last value that are None
if phi_psi[i][0] is not None and phi_psi[i][1] is not None:
for x, y, w, h, ss_c, color in rama_ss_ranges:
if x <= phi_psi[i][0] < x + w and y <= phi_psi[i][
1] < y + h:
ss[i] = ss_c
break
return ss
def test_ppbuilder_torsion(self):
"""Test phi/psi angles calculated with PPBuilder."""
ppb = PPBuilder()
pp = ppb.build_peptides(self.structure)
phi_psi = pp[0].get_phi_psi_list()
self.assertIsNone(phi_psi[0][0])
self.assertAlmostEqual(phi_psi[0][1], -0.46297171497725553, places=3)
self.assertAlmostEqual(phi_psi[1][0], -1.0873937604007962, places=3)
self.assertAlmostEqual(phi_psi[1][1], 2.1337707832637109, places=3)
self.assertAlmostEqual(phi_psi[2][0], -2.4052232743651878, places=3)
self.assertAlmostEqual(phi_psi[2][1], 2.3807316946081554, places=3)
phi_psi = pp[1].get_phi_psi_list()
self.assertIsNone(phi_psi[0][0])
self.assertAlmostEqual(phi_psi[0][1], -0.6810077089092923, places=3)
self.assertAlmostEqual(phi_psi[1][0], -1.2654003477656888, places=3)
self.assertAlmostEqual(phi_psi[1][1], -0.58689987042756309, places=3)
self.assertAlmostEqual(phi_psi[2][0], -1.7467679151684763, places=3)
self.assertAlmostEqual(phi_psi[2][1], -1.5655066256698336, places=3)
phi_psi = pp[2].get_phi_psi_list()
self.assertIsNone(phi_psi[0][0])
self.assertAlmostEqual(phi_psi[0][1], -0.73222884210889716, places=3)
self.assertAlmostEqual(phi_psi[1][0], -1.1044740234566259, places=3)
self.assertAlmostEqual(phi_psi[1][1], -0.69681334592782884, places=3)
self.assertAlmostEqual(phi_psi[2][0], -1.8497413300164958, places=3)
self.assertAlmostEqual(phi_psi[2][1], 0.34762889834809058, places=3)
def test_c_n(self):
"""Extract polypeptides using C-N."""
ppbuild = PPBuilder()
polypeptides = ppbuild.build_peptides(self.structure[1])
self.assertEqual(len(polypeptides), 1)
pp = polypeptides[0]
# Check the start and end positions
self.assertEqual(pp[0].get_id()[1], 2)
self.assertEqual(pp[-1].get_id()[1], 86)
def get_structure_sequence(struct):
# type: (Structure) -> str
"""
Gets the structure sequence using PPBuilder
:param struct: Structure object
:return: struct sequence
"""
ppb = PPBuilder()
return ''.join(
[str(pp.get_sequence()) for pp in ppb.build_peptides(struct)])
def test_polypeptide(self):
"""Tests on polypetide class and methods."""
p = PDBParser(PERMISSIVE=True)
pdb1 = "PDB/1A8O.pdb"
s = p.get_structure("scr", pdb1)
ppb = PPBuilder()
pp = ppb.build_peptides(s)
self.assertEqual(str(pp[0].get_sequence()),
"DIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNW")
self.assertEqual(str(pp[1].get_sequence()),
"TETLLVQNANPDCKTILKALGPGATLEE")
self.assertEqual(str(pp[2].get_sequence()), "TACQG")
phi_psi = pp[0].get_phi_psi_list()
self.assertEqual(phi_psi[0][0], None)
self.assertAlmostEqual(phi_psi[0][1], -0.46297171497725553, places=3)
self.assertAlmostEqual(phi_psi[1][0], -1.0873937604007962, places=3)
self.assertAlmostEqual(phi_psi[1][1], 2.1337707832637109, places=3)
self.assertAlmostEqual(phi_psi[2][0], -2.4052232743651878, places=3)
self.assertAlmostEqual(phi_psi[2][1], 2.3807316946081554, places=3)
phi_psi = pp[1].get_phi_psi_list()
self.assertEqual(phi_psi[0][0], None)
self.assertAlmostEqual(phi_psi[0][1], -0.6810077089092923, places=3)
self.assertAlmostEqual(phi_psi[1][0], -1.2654003477656888, places=3)
self.assertAlmostEqual(phi_psi[1][1], -0.58689987042756309, places=3)
self.assertAlmostEqual(phi_psi[2][0], -1.7467679151684763, places=3)
self.assertAlmostEqual(phi_psi[2][1], -1.5655066256698336, places=3)
phi_psi = pp[2].get_phi_psi_list()
self.assertEqual(phi_psi[0][0], None)
self.assertAlmostEqual(phi_psi[0][1], -0.73222884210889716, places=3)
self.assertAlmostEqual(phi_psi[1][0], -1.1044740234566259, places=3)
self.assertAlmostEqual(phi_psi[1][1], -0.69681334592782884, places=3)
self.assertAlmostEqual(phi_psi[2][0], -1.8497413300164958, places=3)
self.assertAlmostEqual(phi_psi[2][1], 0.34762889834809058, places=3)
ppb = CaPPBuilder()
pp = ppb.build_peptides(s)
self.assertEqual(str(pp[0].get_sequence()),
"DIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNW")
self.assertEqual(str(pp[1].get_sequence()),
"TETLLVQNANPDCKTILKALGPGATLEE")
self.assertEqual(str(pp[2].get_sequence()), "TACQG")
self.assertEqual([ca.serial_number for ca in pp[0].get_ca_list()], [
10, 18, 26, 37, 46, 50, 57, 66, 75, 82, 93, 104, 112, 124, 131,
139, 150, 161, 173, 182, 189, 197, 208, 213, 222, 231, 236, 242,
251, 260, 267, 276, 284
])
taus = pp[1].get_tau_list()
self.assertAlmostEqual(taus[0], 0.3597907225123525, places=3)
self.assertAlmostEqual(taus[1], 0.43239284636769254, places=3)
self.assertAlmostEqual(taus[2], 0.99820157492712114, places=3)
thetas = pp[2].get_theta_list()
self.assertAlmostEqual(thetas[0], 1.6610069445335354, places=3)
self.assertAlmostEqual(thetas[1], 1.7491703334817772, places=3)
self.assertAlmostEqual(thetas[2], 2.0702447422720143, places=3)
def is_protein(chain):
"""
Check if chain is a protein.
:param chain:
:return:
"""
ppb = PPBuilder()
for pp in ppb.build_peptides(chain):
if len(pp.get_sequence()) > 0:
return True
return False
def chain_to_one_pp(chain):
ppb = PPBuilder()
polypeptides = ppb.build_peptides(chain)
if len(polypeptides) != 1:
print('warning ', len(polypeptides),
' polypeptides from one chain, extending first pp')
for pp in polypeptides[1:]:
polypeptides[0].extend(pp)
return polypeptides[0]
def structure_filtered_dca_get_sequence_from_structure(structure):
from Bio.PDB import PPBuilder
sequence = ""
ppb = PPBuilder(radius=10.0)
for pp in ppb.build_peptides(structure, aa_only=False):
sequence += '%s\n' % pp.get_sequence()
return sequence.replace('\n', '')
def run_test():
from Bio.PDB import PDBParser, PPBuilder, CaPPBuilder
# first make a PDB parser object
p=PDBParser(PERMISSIVE=1)
# get the structure, call it "example"
structure=p.get_structure("example", "PDB/a_structure.pdb")
# now loop over content and print some info
for model in structure.get_list():
model_id=model.get_id()
print "Model %i contains %i chains." % (model_id, len(model))
for chain in model.get_list():
chain_id=chain.get_id()
print "\tChain '%s' contains %i residues." % (chain_id, len(chain))
for residue in chain.get_list():
residue_id=residue.get_id()
hetfield, resseq, icode=residue_id
print "\t\tResidue ('%s', %i, '%s') contains %i atoms." % (hetfield, resseq, icode, len(residue))
# check if there is disorder due to a point mutation --- this is rare
if residue.is_disordered()==2:
print "\t\t\tThere is a point mutation present in the crystal at this position."
s="\t\t\tResidues at this position are "
for resname in residue.disordered_get_id_list():
s=s+resname+" "
print s[:-1]+"."
# count the number of disordered atoms
if residue.is_disordered()==1:
disordered_count=0
for atom in residue.get_list():
if atom.is_disordered():
disordered_count=disordered_count+1
if disordered_count>0:
print "\t\t\tThe residue contains %i disordered atoms." % disordered_count
print "Polypeptides using C-N"
ppb=PPBuilder()
for pp in ppb.build_peptides(structure[1]):
print pp
print "Polypeptides using CA-CA"
ppb=CaPPBuilder()
for pp in ppb.build_peptides(structure[1]):
print pp
print "NeighborSearch test"
quick_neighbor_search_test()
def run(infile, splitpdb):
parser = PDBParser()
struct = parser.get_structure('mystruct', infile)
ppb = PPBuilder()
basename = os.path.basename(infile)
prefix = os.path.splitext(basename)[0]
if splitpdb == 0: # We do NOT split the PDB and fasta files!
seqfile = open(prefix + '.fasta', 'w')
pdbio = PDBIO_RPL.PDBIO()
pdbio.set_structure(struct)
cleanfile = prefix + '_clean.pdb'
pdbio.save(cleanfile)
ListChains = []
for model in struct:
for chain in model:
ListChains.append(chain.id)
ListPpdb = ppb.build_peptides(chain)
if (len(ListPpdb) > 0):
for index, pp in enumerate(ListPpdb):
# print(chain.id,index,pp.get_sequence(),pp
if splitpdb == 1: # We split the PDB and fasta files!
seqfile = open(
prefix + '_' + chain.id + '.' + str(index) +
'.fasta', 'w')
seq = pp.get_sequence()
seqfile.write('>%s %s\n' % (prefix + '_chain_' + chain.id +
'_' + str(index), len(seq)))
seqfile.write('%s' % seq)
seqfile.write('\n')
if splitpdb == 1: # We split the PDB and fasta files!
seqfile.close()
startres = pp[0].id[1]
endres = pp[-1].id[1]
ofile = prefix + '_' + chain.id + '.' + str(
index) + '.pdb'
Dice_RPL.extract(struct, chain.id, startres, endres,
ofile)
else:
# Also split chains that do not consist of amino acids!
ChainList = chain.get_list()
startres = ChainList[0].id[1]
endres = ChainList[0].id[-1]
ofile = prefix + '_' + chain.id + '.' + str(index) + '.pdb'
Dice_RPL.extract(struct, chain.id, startres, endres, ofile)
if splitpdb == 0: # We do NOT split the PDB and fasta files!
seqfile.close()
return ListChains
def run_test():
from Bio.PDB import PDBParser, PPBuilder, CaPPBuilder
# first make a PDB parser object
p = PDBParser(PERMISSIVE=1)
# get the structure, call it "example"
structure = p.get_structure("example", "PDB/a_structure.pdb")
# now loop over content and print some info
for model in structure.get_list():
model_id = model.get_id()
print "Model %i contains %i chains." % (model_id, len(model))
for chain in model.get_list():
chain_id = chain.get_id()
print "\tChain '%s' contains %i residues." % (chain_id, len(chain))
for residue in chain.get_list():
residue_id = residue.get_id()
hetfield, resseq, icode = residue_id
print "\t\tResidue ('%s', %i, '%s') contains %i atoms." % (
hetfield, resseq, icode, len(residue))
# check if there is disorder due to a point mutation --- this is rare
if residue.is_disordered() == 2:
print "\t\t\tThere is a point mutation present in the crystal at this position."
s = "\t\t\tResidues at this position are "
for resname in residue.disordered_get_id_list():
s = s + resname + " "
print s[:-1] + "."
# count the number of disordered atoms
if residue.is_disordered() == 1:
disordered_count = 0
for atom in residue.get_list():
if atom.is_disordered():
disordered_count = disordered_count + 1
if disordered_count > 0:
print "\t\t\tThe residue contains %i disordered atoms." % disordered_count
print "Polypeptides using C-N"
ppb = PPBuilder()
for pp in ppb.build_peptides(structure[1]):
print pp
print "Polypeptides using CA-CA"
ppb = CaPPBuilder()
for pp in ppb.build_peptides(structure[1]):
print pp
print "NeighborSearch test"
quick_neighbor_search_test()
def test_c_n(self):
"""Extract polypeptides using C-N."""
ppbuild = PPBuilder()
polypeptides = ppbuild.build_peptides(self.structure[1])
self.assertEqual(len(polypeptides), 1)
pp = polypeptides[0]
# Check the start and end positions
self.assertEqual(pp[0].get_id()[1], 2)
self.assertEqual(pp[-1].get_id()[1], 86)
# Check the sequence
s = pp.get_sequence()
self.assertTrue(isinstance(s, Seq))
self.assertEqual(s.alphabet, generic_protein)
self.assertEqual("RCGSQGGGSTCPGLRCCSIWGWCGDSEPYCGRTCENKCWSGER"
"SDHRCGAAVGNPPCGQDRCCSVHGWCGGGNDYCSGGNCQYRC",
str(s))
def test_insertions(self):
"""Test file with residue insertion codes."""
parser = MMCIFParser(QUIET=1)
with warnings.catch_warnings():
warnings.simplefilter("ignore", PDBConstructionWarning)
structure = parser.get_structure("example", "PDB/4ZHL.cif")
for ppbuild in [PPBuilder(), CaPPBuilder()]:
# First try allowing non-standard amino acids,
polypeptides = ppbuild.build_peptides(structure[0], False)
self.assertEqual(len(polypeptides), 2)
pp = polypeptides[0]
# Check the start and end positions (first segment only)
self.assertEqual(pp[0].get_id()[1], 16)
self.assertEqual(pp[-1].get_id()[1], 244)
# Check the sequence
refseq = (
"IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGR"
"SRLNSNTQGEMKFEVENLILHKDYSADTLAYHNDIALLKIRSKEGRCAQPSRTIQTIALPSMY"
"NDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQW"
"KTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE"
)
s = pp.get_sequence()
self.assertIsInstance(s, Seq)
self.assertEqual(s.alphabet, generic_protein)
self.assertEqual(refseq, str(s))
def read_pdb_file(file_name, name=None):
"""
Extract info from a PDB file
file_name: path of pdb file
name: name of the structure (default name of the file without extension)
return:: (structure,R,polypeptides,sequence,seq_res_dict)
structure: structure object
residues: list of residues
polypeptides: list of polypeptides in the structure
sequence: combined sequence (for all polypeptides)
seq_res_dict: Sequence to residues mapping index list, sequence[i] corresponds to
residues[seq_res_dict[i]]
"""
if name is None:
name = splitext(file_name)[0]
structure = PDBParser().get_structure(name, file_name)
if len(structure) != 1:
raise ValueError("Unexpected number of structures in " + name)
# residues = Selection.unfold_entities(structure, 'R')
atoms = Selection.unfold_entities(structure, 'A')
polypeptides = PPBuilder().build_peptides(structure)
if len(polypeptides) == 0:
polypeptides = CaPPBuilder().build_peptides(structure)
sequence = ''.join([str(p.get_sequence()) for p in polypeptides])
residues = [
residue for polypeptide in polypeptides for residue in polypeptide
]
protein_name = os.path.basename(file_name).replace(".pdb", "")
return protein_name, structure, residues, sequence, atoms
def get_sequence(self, chain_id):
"""
Input:
self: Use Biopython.PDB structure which has been stored in an object variable
chain_id : String (usually in ['A','B', 'C' ...]. The number of chains
depends on the specific protein and the resulting structure)
Return:
Return the amino acid sequence (single-letter alphabet!) of a given chain (chain_id)
in a Biopython.PDB structure as a string.
"""
sequence = 'SEQWENCE'
ppb = PPBuilder()
for pp in ppb.build_peptides(self.structure[0][chain_id]):
return pp.get_sequence()
def test_c_n(self):
"""Extract polypeptides using C-N."""
ppbuild = PPBuilder()
polypeptides = ppbuild.build_peptides(self.structure[1])
self.assertEqual(len(polypeptides), 1)
pp = polypeptides[0]
# Check the start and end positions
self.assertEqual(pp[0].get_id()[1], 2)
self.assertEqual(pp[-1].get_id()[1], 86)
# Check the sequence
s = pp.get_sequence()
self.assertTrue(isinstance(s, Seq))
self.assertEqual(s.alphabet, generic_protein)
self.assertEqual("RCGSQGGGSTCPGLRCCSIWGWCGDSEPYCGRTCENKCWSGER"
"SDHRCGAAVGNPPCGQDRCCSVHGWCGGGNDYCSGGNCQYRC",
str(s))
def _pp(self, pdb_path, chain_id):
pdb_id = Path(pdb_path).stem
pp_list = PPBuilder().build_peptides(PDBParser().get_structure(
pdb_id, pdb_path)[0][chain_id])
pp = pp_list[0]
for i in pp_list[1:]:
pp += i
return pp
def test_polypeptide(self):
"""Tests on polypetide class and methods."""
p = PDBParser(PERMISSIVE=True)
pdb1 = "PDB/1A8O.pdb"
s = p.get_structure("scr", pdb1)
ppb = PPBuilder()
pp = ppb.build_peptides(s)
self.assertEqual(str(pp[0].get_sequence()), "DIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNW")
self.assertEqual(str(pp[1].get_sequence()), "TETLLVQNANPDCKTILKALGPGATLEE")
self.assertEqual(str(pp[2].get_sequence()), "TACQG")
phi_psi = pp[0].get_phi_psi_list()
self.assertEqual(phi_psi[0][0], None)
self.assertAlmostEqual(phi_psi[0][1], -0.46297171497725553, places=3)
self.assertAlmostEqual(phi_psi[1][0], -1.0873937604007962, places=3)
self.assertAlmostEqual(phi_psi[1][1], 2.1337707832637109, places=3)
self.assertAlmostEqual(phi_psi[2][0], -2.4052232743651878, places=3)
self.assertAlmostEqual(phi_psi[2][1], 2.3807316946081554, places=3)
phi_psi = pp[1].get_phi_psi_list()
self.assertEqual(phi_psi[0][0], None)
self.assertAlmostEqual(phi_psi[0][1], -0.6810077089092923, places=3)
self.assertAlmostEqual(phi_psi[1][0], -1.2654003477656888, places=3)
self.assertAlmostEqual(phi_psi[1][1], -0.58689987042756309, places=3)
self.assertAlmostEqual(phi_psi[2][0], -1.7467679151684763, places=3)
self.assertAlmostEqual(phi_psi[2][1], -1.5655066256698336, places=3)
phi_psi = pp[2].get_phi_psi_list()
self.assertEqual(phi_psi[0][0], None)
self.assertAlmostEqual(phi_psi[0][1], -0.73222884210889716, places=3)
self.assertAlmostEqual(phi_psi[1][0], -1.1044740234566259, places=3)
self.assertAlmostEqual(phi_psi[1][1], -0.69681334592782884, places=3)
self.assertAlmostEqual(phi_psi[2][0], -1.8497413300164958, places=3)
self.assertAlmostEqual(phi_psi[2][1], 0.34762889834809058, places=3)
ppb = CaPPBuilder()
pp = ppb.build_peptides(s)
self.assertEqual(str(pp[0].get_sequence()), "DIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNW")
self.assertEqual(str(pp[1].get_sequence()), "TETLLVQNANPDCKTILKALGPGATLEE")
self.assertEqual(str(pp[2].get_sequence()), "TACQG")
self.assertEqual([ca.serial_number for ca in pp[0].get_ca_list()], [10, 18, 26, 37, 46, 50, 57, 66, 75, 82, 93, 104, 112, 124, 131, 139, 150, 161, 173, 182, 189, 197, 208, 213, 222, 231, 236, 242, 251, 260, 267, 276, 284])
taus = pp[1].get_tau_list()
self.assertAlmostEqual(taus[0], 0.3597907225123525, places=3)
self.assertAlmostEqual(taus[1], 0.43239284636769254, places=3)
self.assertAlmostEqual(taus[2], 0.99820157492712114, places=3)
thetas = pp[2].get_theta_list()
self.assertAlmostEqual(thetas[0], 1.6610069445335354, places=3)
self.assertAlmostEqual(thetas[1], 1.7491703334817772, places=3)
self.assertAlmostEqual(thetas[2], 2.0702447422720143, places=3)
def test_ppbuilder_real_nonstd(self):
"""Test PPBuilder on real PDB file allowing non-standard amino acids."""
ppb = PPBuilder()
pp = ppb.build_peptides(self.structure, False)
self.assertEqual(len(pp), 1)
# Check the start and end positions
self.assertEqual(pp[0][0].get_id()[1], 151)
self.assertEqual(pp[0][-1].get_id()[1], 220)
# Check the sequence
s = pp[0].get_sequence()
self.assertIsInstance(s, Seq)
# Here non-standard MSE are shown as M
self.assertEqual(
"MDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQG",
s)
def getSeqLocation(self, seq): # return sequence position and chain id ppb=PPBuilder() bltpep = ppb.build_peptides(self.__struct[0]) for pp in bltpep: beg = 0 end = 0 s = str(pp.get_sequence()) ind = s.find(seq, 0, len(s)) if (ind != -1): beg = beg + ind end = beg + len(seq) - 1 chain = pp[0].get_parent().get_id() break if beg == end == 0: line = '\n' + seq + ' not found in '+str(self.__struct.get_id()) + '!\n' self.printerr(line) return None, None, None return beg, end, chain
def get_sequence(pdb, chain):
pdb_parser = PDBParser(PERMISSIVE=0) # The PERMISSIVE instruction allows PDBs presenting errors.
pdb_structure = pdb_parser.get_structure(pdb,pdb)
pdb_chain = pdb_structure[0][chain]
ppb=PPBuilder()
Sequence = ""
for pp in ppb.build_peptides(pdb_chain):
Sequence = Sequence + pp.get_sequence()
io = PDBIO()
io.set_structure(pdb_structure)
output = pdb[-8:-4] +"_"+chain+".pdb"
# output = pdb
out = open(output[:-4]+chain+".fasta.txt","w")
out.write(">"+pdb[:-4]+chain+"\n")
out.write(str(Sequence)+"\n")
out.close()
io.save(output,SelectChains(chain))
def get_pp(pdb, chain, start, length, seq):
"""retrieve the residiues for a given pdb file and chain as polypeptides"""
f = make_filename(pdb)
p = PDBParser(PERMISSIVE=1)
pdb_struct = p.get_structure(
pdb, f) # Load the pdb structure pdb contained on the file f.
pdb_chain = pdb_struct[0][
chain] # Select the right Chain of the structure.
ppb = PPBuilder() # Initialize a peptide builder.
peptides = ppb.build_peptides(
pdb_chain) # Load the given chain as a peptide.
for i, pep in enumerate(peptides):
if str(pep.get_sequence()).find(seq) != -1:
start = str(pep.get_sequence()).find(seq)
break
if start > 0 and (start + length + 2) <= len(pep):
pp = pep[(start - 1):(start + length + 2)]
return pp
else:
raise
def test_parser(self):
"""Extract polypeptides from 1A80."""
parser = MMCIFParser()
structure = parser.get_structure("example", "PDB/1A8O.cif")
self.assertEqual(len(structure), 1)
for ppbuild in [PPBuilder(), CaPPBuilder()]:
# ==========================================================
# Check that serial_num (model column) is stored properly
self.assertEqual(structure[0].serial_num, 1)
# First try allowing non-standard amino acids,
polypeptides = ppbuild.build_peptides(structure[0], False)
self.assertEqual(len(polypeptides), 1)
pp = polypeptides[0]
# Check the start and end positions
self.assertEqual(pp[0].get_id()[1], 151)
self.assertEqual(pp[-1].get_id()[1], 220)
# Check the sequence
s = pp.get_sequence()
self.assertTrue(isinstance(s, Seq))
self.assertEqual(s.alphabet, generic_protein)
# Here non-standard MSE are shown as M
self.assertEqual(
"MDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQ"
"NANPDCKTILKALGPGATLEEMMTACQG", str(s))
# ==========================================================
# Now try strict version with only standard amino acids
# Should ignore MSE 151 at start, and then break the chain
# at MSE 185, and MSE 214,215
polypeptides = ppbuild.build_peptides(structure[0], True)
self.assertEqual(len(polypeptides), 3)
# First fragment
pp = polypeptides[0]
self.assertEqual(pp[0].get_id()[1], 152)
self.assertEqual(pp[-1].get_id()[1], 184)
s = pp.get_sequence()
self.assertTrue(isinstance(s, Seq))
self.assertEqual(s.alphabet, generic_protein)
self.assertEqual("DIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNW", str(s))
# Second fragment
pp = polypeptides[1]
self.assertEqual(pp[0].get_id()[1], 186)
self.assertEqual(pp[-1].get_id()[1], 213)
s = pp.get_sequence()
self.assertTrue(isinstance(s, Seq))
self.assertEqual(s.alphabet, generic_protein)
self.assertEqual("TETLLVQNANPDCKTILKALGPGATLEE", str(s))
# Third fragment
pp = polypeptides[2]
self.assertEqual(pp[0].get_id()[1], 216)
self.assertEqual(pp[-1].get_id()[1], 220)
s = pp.get_sequence()
self.assertTrue(isinstance(s, Seq))
self.assertEqual(s.alphabet, generic_protein)
self.assertEqual("TACQG", str(s))
def getRegionsResidues(self): # fill self.__regions_res dictionary with list of residues
ppb=PPBuilder() # for every region contained in self.__regions_res
res = []
bltpep = ppb.build_peptides(self.__struct[0])
for key in self.__regions_res:
for pp in bltpep:
s = str(pp.get_sequence())
reg_seq = list(self.__regions.get_group(key)['tcr_region_seq'])[0]
ind = s.find(reg_seq, 0, len(s))
if (ind != -1):
for i in range(ind, ind + len(reg_seq)):
res.append(pp[i])
self.__regions_res[key] = res
break
if not res:
line = '\n' + reg_seq + ' not found in '+ self.__name + '!\n'
self.printerr('getRegionResidues(): ' + line)
return 0
res = []
return 1
def testModels(self):
"""Test file with multiple models."""
parser = MMCIFParser(QUIET=1)
f_parser = FastMMCIFParser(QUIET=1)
with warnings.catch_warnings():
warnings.simplefilter("ignore", PDBConstructionWarning)
structure = parser.get_structure("example", "PDB/1LCD.cif")
f_structure = f_parser.get_structure("example", "PDB/1LCD.cif")
self.assertEqual(len(structure), 3)
self.assertEqual(len(f_structure), 3)
for ppbuild in [PPBuilder(), CaPPBuilder()]:
# ==========================================================
# Check that serial_num (model column) is stored properly
self.assertEqual(structure[0].serial_num, 1)
self.assertEqual(structure[1].serial_num, 2)
self.assertEqual(structure[2].serial_num, 3)
# First try allowing non-standard amino acids,
polypeptides = ppbuild.build_peptides(structure[0], False)
self.assertEqual(len(polypeptides), 1)
pp = polypeptides[0]
# Check the start and end positions
self.assertEqual(pp[0].get_id()[1], 1)
self.assertEqual(pp[-1].get_id()[1], 51)
# Check the sequence
s = pp.get_sequence()
self.assertIsInstance(s, Seq)
self.assertEqual(s.alphabet, generic_protein)
# Here non-standard MSE are shown as M
self.assertEqual(
"MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNR", str(s)
)
# ==========================================================
# Now try strict version with only standard amino acids
polypeptides = ppbuild.build_peptides(structure[0], True)
self.assertEqual(len(polypeptides), 1)
pp = polypeptides[0]
# Check the start and end positions
self.assertEqual(pp[0].get_id()[1], 1)
self.assertEqual(pp[-1].get_id()[1], 51)
# Check the sequence
s = pp.get_sequence()
self.assertIsInstance(s, Seq)
self.assertEqual(s.alphabet, generic_protein)
self.assertEqual(
"MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNR", str(s)
)
# This structure contains several models with multiple lengths.
# The tests were failing.
structure = parser.get_structure("example", "PDB/2OFG.cif")
self.assertEqual(len(structure), 3)
def get_sequence(pdb, chain):
if chain is "%":
chain = " "
warnings.filterwarnings('always', message='.*discontinuous at.*')
pdb_parser = PDBParser(
PERMISSIVE=0, QUIET=True
) # The PERMISSIVE instruction allows PDBs presenting errors.
pdb_structure = pdb_parser.get_structure(pdb, pdb)
pdb_chain = pdb_structure[0][chain]
ppb = PPBuilder()
Sequence = ""
for pp in ppb.build_peptides(pdb_chain, aa_only=False):
Sequence = Sequence + pp.get_sequence()
io = PDBIO()
io.set_structure(pdb_structure)
output = pdb[0:-4] + ".pdb"
out = open(output[:-4] + ".fasta.atom", "w")
out.write(">" + pdb[0:-4] + "\n")
out.write(str(Sequence) + "\n")
out.close()
def get_sequence(pdb, chain, first, last, output):
pdb_parser = PDBParser(PERMISSIVE=0) # The PERMISSIVE instruction allows PDBs presenting errors.
pdb_structure = pdb_parser.get_structure(pdb,pdb)
pdb_chain = pdb_structure[0][chain]
ppb=PPBuilder()
Sequence = ""
for pp in ppb.build_peptides(pdb_chain):
Sequence = Sequence + pp.get_sequence()
io = PDBIO()
io.set_structure(pdb_structure)
# if pdb[-5] == chain:
# output = pdb
# else:
# output = pdb[:-4]+chain+".pdb"
### writing out sequence to fasta
# out = open(output[:-4]+".fasta.txt","w")
# out.write(">"+output[:-4]+"\n")
# out.write(str(Sequence[first-1: last-2])+"\n")
# out.close()
io.save(output,SelectDomain(chain, first, last))
def test_ppbuilder_real(self):
"""Test PPBuilder on real PDB file."""
ppb = PPBuilder()
pp = ppb.build_peptides(self.structure)
self.assertEqual(len(pp), 3)
# Check termini
self.assertEqual(pp[0][0].get_id()[1], 152)
self.assertEqual(pp[0][-1].get_id()[1], 184)
self.assertEqual(pp[1][0].get_id()[1], 186)
self.assertEqual(pp[1][-1].get_id()[1], 213)
self.assertEqual(pp[2][0].get_id()[1], 216)
self.assertEqual(pp[2][-1].get_id()[1], 220)
# Now check sequences
pp0_seq = pp[0].get_sequence()
pp1_seq = pp[1].get_sequence()
pp2_seq = pp[2].get_sequence()
self.assertIsInstance(pp0_seq, Seq)
self.assertEqual(pp0_seq, "DIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNW")
self.assertEqual(pp1_seq, "TETLLVQNANPDCKTILKALGPGATLEE")
self.assertEqual(pp2_seq, "TACQG")
def get_sequence(pdb, chain):
pdb_parser = PDBParser(
PERMISSIVE=0
) # The PERMISSIVE instruction allows PDBs presenting errors.
pdb_structure = pdb_parser.get_structure(pdb, pdb)
pdb_chain = pdb_structure[0][chain]
ppb = PPBuilder()
Sequence = ""
for pp in ppb.build_peptides(pdb_chain):
Sequence = Sequence + pp.get_sequence()
start = [residue.id[1] for residue in pdb_chain][0]
if start is not 1:
for residue in pdb_chain:
residue.id = (' ', residue.id[1] - start + 1, ' ')
io = PDBIO()
io.set_structure(pdb_structure)
# output = pdb[-8:-4] +"_"+chain+".pdb"
output = "renumbered_" + pdb
# out = open(output[:-4]+".fasta.txt","w")
# out.write(">"+pdb[-8:-4]+"_"+chain+"\n")
# out.write(str(Sequence))
# out.close()
io.save(output, SelectChains(chain))
def get_ignored_res(file: str):
x, y, ignored, output = [], [], [], {}
for model in PDBParser().get_structure(id=None, file=file):
for chain in model:
peptides = PPBuilder().build_peptides(chain)
for peptide in peptides:
for aa, angles in zip(peptide, peptide.get_phi_psi_list()):
residue = chain.id + ":" + aa.resname + str(aa.id[1])
output[residue] = angles
for key, value in output.items():
# Only get residues with both phi and psi angles
if value[0] and value[1]:
x.append(value[0] * 180 / pi)
y.append(value[1] * 180 / pi)
else:
ignored.append((key, value))
return output, ignored, x, y
def split_pdb_by_chain(pdb_id):
if not os.path.isdir("pdb_chains/" + pdb_id.upper()):
os.mkdir("pdb_chains/" + pdb_id.upper())
actual_pdbfile = PDBParser().get_structure(
pdb_id, "ent_files/pdb" + pdb_id.lower() + ".ent")
return_dict = dict()
for model in actual_pdbfile:
for chain in model:
outfilename = pdb_id.upper() + "-" + str(
model.get_id() + 1) + "_" + str(chain.get_id()) + ".pdb"
if not os.path.isfile("pdb_chains/" + pdb_id.upper() + "/" +
outfilename):
io = PDBIO()
io.set_structure(chain)
io.save("pdb_chains/" + pdb_id.upper() + "/" + outfilename)
ppb = PPBuilder().build_peptides(chain)
this_seq = Seq("", generic_protein)
for pp in ppb:
this_seq += pp.get_sequence()
return_dict[outfilename] = this_seq
return return_dict
def testModels(self):
"""Test file with multiple models"""
parser = MMCIFParser()
structure = parser.get_structure("example", "PDB/1LCD.cif")
self.assertEqual(len(structure), 3)
for ppbuild in [PPBuilder(), CaPPBuilder()]:
#==========================================================
# Check that serial_num (model column) is stored properly
self.assertEqual(structure[0].serial_num, 1)
self.assertEqual(structure[1].serial_num, 2)
self.assertEqual(structure[2].serial_num, 3)
#First try allowing non-standard amino acids,
polypeptides = ppbuild.build_peptides(structure[0], False)
self.assertEqual(len(polypeptides), 1)
pp = polypeptides[0]
# Check the start and end positions
self.assertEqual(pp[0].get_id()[1], 1)
self.assertEqual(pp[-1].get_id()[1], 51)
# Check the sequence
s = pp.get_sequence()
self.assertTrue(isinstance(s, Seq))
self.assertEqual(s.alphabet, generic_protein)
#Here non-standard MSE are shown as M
self.assertEqual(
"MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNR", str(s))
#==========================================================
#Now try strict version with only standard amino acids
polypeptides = ppbuild.build_peptides(structure[0], True)
self.assertEqual(len(polypeptides), 1)
pp = polypeptides[0]
# Check the start and end positions
self.assertEqual(pp[0].get_id()[1], 1)
self.assertEqual(pp[-1].get_id()[1], 51)
# Check the sequence
s = pp.get_sequence()
self.assertTrue(isinstance(s, Seq))
self.assertEqual(s.alphabet, generic_protein)
self.assertEqual(
"MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNR", str(s))
def create_rotamers(self, structure, pdb_path):
wt_lookup = {} #used to match WT seq_number to WT residue record
pdbseq = {} #used to keep track of pdbseq residue positions vs index in seq
ref_positions = {} #WT postions in alignment
mapped_seq = {} # index in contruct, tuple of AA and WT [position,AA]
preferred_chain = structure.preferred_chain
if len(preferred_chain.split(','))>1: #if A,B
preferred_chain = preferred_chain.split(',')[0]
AA = {'ALA':'A', 'ARG':'R', 'ASN':'N', 'ASP':'D',
'CYS':'C', 'GLN':'Q', 'GLU':'E', 'GLY':'G',
'HIS':'H', 'ILE':'I', 'LEU':'L', 'LYS':'K',
'MET':'M', 'PHE':'F', 'PRO':'P', 'SER':'S',
'THR':'T', 'TRP':'W', 'TYR':'Y', 'VAL':'V'}
s = PDBParser(PERMISSIVE=True, QUIET=True).get_structure('ref', pdb_path)[0]
chain = s[preferred_chain] #select only one chain (avoid n-mer receptors)
ppb=PPBuilder()
seq = ''
i = 1
check_1000 = 0
for pp in ppb.build_peptides(chain): #remove >1000 pos (fusion protein / gprotein)
for res in pp:
id = res.id
if id[1]<600:
check_1000 += 1
#need check_1000 to catch structures where they lie in 1000s (4LDE, 4LDL, 4LDO, 4N4W, 4QKX)
if id[1]>1000 and check_1000>200:
chain.detach_child(id)
for pp in ppb.build_peptides(chain):
seq += str(pp.get_sequence()) #get seq from fasta (only chain A)
for residue in pp:
residue_id = residue.get_full_id()
chain = residue_id[2]
if chain not in pdbseq:
pdbseq[chain] = {}
pos = residue_id[3][1]
pdbseq[chain][pos] = [i,AA[residue.resname]]
i += 1
parent_seq = str(structure.protein_conformation.protein.parent.sequence)
rs = Residue.objects.filter(protein_conformation__protein=structure.protein_conformation.protein.parent).prefetch_related('display_generic_number','generic_number','protein_segment')
for r in rs: #required to match WT position to a record (for duplication of GN values)
wt_lookup[r.sequence_number] = r
#align WT with structure seq -- make gaps penalties big, so to avoid too much overfitting
pw2 = pairwise2.align.localms(parent_seq, seq, 2, -4, -4, -.1)
gaps = 0
unmapped_ref = {}
for i, r in enumerate(pw2[0][0], 1): #loop over alignment to create lookups (track pos)
#print(i,r,pw2[0][1][i-1]) #print alignment for sanity check
if r == "-":
gaps += 1
if r != "-":
ref_positions[i] = [i-gaps,r]
elif r == "-":
ref_positions[i] = [None,'-']
if pw2[0][1][i-1]=='-':
unmapped_ref[i-gaps] = '-'
gaps = 0
for i, r in enumerate(pw2[0][1], 1): #make second lookup
if r == "-":
gaps += 1
if r != "-":
mapped_seq[i-gaps] = [r,ref_positions[i]]
pdb = structure.pdb_data.pdb
protein_conformation=structure.protein_conformation
temp = ''
check = 0
errors = 0
mismatch_seq = 0
match_seq = 0
not_matched = 0
matched_by_pos = 0
aa_mismatch = 0
pdblines_temp = pdb.splitlines()
pdblines = []
for line in pdblines_temp: #Get rid of all odd records
if line.startswith('ATOM'):
pdblines.append(line)
pdblines.append('') #add a line to not "run out"
for i,line in enumerate(pdblines):
if line.startswith('ATOM'):
chain = line[21]
if preferred_chain and chain!=preferred_chain: #If perferred is defined and is not the same as the current line, then skip
pass
else:
nextline = pdblines[i+1]
residue_number = line[22:26].strip()
if (check==0 or nextline[22:26].strip()==check) and nextline.startswith('TER')==False and nextline.startswith('ATOM')==True: #If this is either the begining or the same as previous line add to current rotamer
temp += line + "\n"
#print('same res',pdb.splitlines()[i+1])
else: #if this is a new residue
#print(pdb.splitlines()[i+1][22:26].strip(),check)
temp += line + "\n"
if int(check.strip())<2000:
residue = Residue()
residue.sequence_number = int(check.strip())
residue.amino_acid = AA[residue_name.upper()]
residue.protein_conformation = protein_conformation
#print(residue.sequence_number,residue.amino_acid) #sanity check
try:
seq_num_pos = pdbseq[chain][residue.sequence_number][0]
except:
#print('failed residue',pdb_path,residue.sequence_number)
temp = "" #start new line for rotamer
check = pdblines[i+1][22:26].strip()
continue
if seq_num_pos in mapped_seq:
if mapped_seq[seq_num_pos][1][0]==None:
#print('no match found') #sanity check
#print(residue.sequence_number,residue.amino_acid) #sanity check
residue.display_generic_number = None
residue.generic_number = None
residue.protein_segment = None
not_matched +=1
else:
wt_r = wt_lookup[mapped_seq[seq_num_pos][1][0]]
if residue.sequence_number!=wt_r.sequence_number and residue.amino_acid!=wt_r.amino_acid and residue.sequence_number in wt_lookup: #if pos numbers not work -- see if the pos number might be in WT and unmapped
if wt_lookup[residue.sequence_number].amino_acid==residue.amino_acid:
if residue.sequence_number in unmapped_ref: #WT was not mapped, so could be it
# print(residue.sequence_number,residue.amino_acid) #sanity check
#print('wrongly matched, better match on pos+aa',residue.sequence_number,residue.amino_acid,wt_r.sequence_number,wt_r.amino_acid)
wt_r = wt_lookup[residue.sequence_number]
matched_by_pos +=1
match_seq += 1
else:
mismatch_seq += 1
#print('could have been matched, but already aligned to another position',residue.sequence_number,residue.amino_acid,wt_r.sequence_number,wt_r.amino_acid)
else:
#print('WT pos not same AA, mismatch',residue.sequence_number,residue.amino_acid,wt_r.sequence_number,wt_r.amino_acid)
mismatch_seq += 1
elif residue.sequence_number!=wt_r.sequence_number:
#print('WT pos not same pos, mismatch',residue.sequence_number,residue.amino_acid,wt_r.sequence_number,wt_r.amino_acid)
mismatch_seq += 1
elif residue.amino_acid!=wt_r.amino_acid:
#print('aa mismatch',residue.sequence_number,residue.amino_acid,wt_r.sequence_number,wt_r.amino_acid)
aa_mismatch += 1
else:
match_seq += 1
if wt_r.generic_number is not None:
residue.display_generic_number = wt_r.display_generic_number
residue.generic_number = wt_r.generic_number
else:
residue.display_generic_number = None
residue.generic_number = None
#print('no GN')
residue.protein_segment = wt_r.protein_segment
else:
#print('wierd error') #sanity check
residue.display_generic_number = None
residue.generic_number = None
residue.protein_segment = None
#print('inserted',residue.sequence_number) #sanity check
residue.save()
rotamer_data, created = PdbData.objects.get_or_create(pdb=temp)
rotamer, created = Rotamer.objects.get_or_create(residue=residue, structure=structure, pdbdata=rotamer_data)
temp = "" #start new line for rotamer
check = pdblines[i+1][22:26].strip()
check = pdblines[i+1][22:26].strip()
chain = line[21]
residue_name = line[17:20].title() #use title to get GLY to Gly so it matches
#print(structure.pdb_code.index,'length',len(seq),len(mapped_seq),'mapped res',str(mismatch_seq+match_seq+aa_mismatch),'pos mismatch',mismatch_seq,'aa mismatch',aa_mismatch,'not mapped',not_matched,' mapping off, matched on pos,aa',matched_by_pos)
return None
from Bio.PDB import PDBParser from Bio.PDB import PPBuilder from Bio.PDB import Polypeptide item = '2bnr' structure = PDBParser().get_structure(item, '../pdbs/'+item+'.pdb') ppb=PPBuilder() peps = ppb.build_peptides(structure) print structure.get_id() print peps[0] #print peps[0][1:-3] print peps[0][3:9] p = peps[0][3:9] print peps[0][1].get_resname()
# n += 1
# list[n].append(atom)
# previous = atom
# return list
if __name__ == "__main__":
current_path = os.path.dirname(sys.argv[0])
pdb_path = current_path + '../pdb/'
pdb_id = '2vb1'
structure = get_structure(pdb_id, pdb_path)
model = structure[0]
ppb = PPBuilder()
pp_list = ppb.build_peptides(model)
# orient
orient(pp_list)
# first split stage
fs = first_split(pp_list)
for seg in fs:
pp = Polypeptide.Polypeptide(seg)
print pp.get_sequence()