def test_name(self): self.assertEqual(self.sgc.name, 'Standard') self.assertEqual(GeneticCode('M' * 64, '-' * 64).name, '') self.assertEqual(GeneticCode('M' * 64, '-' * 64, 'foo').name, 'foo') with self.assertRaises(AttributeError): self.sgc.name = 'foo'
def test_eq(self): amino_acids = 'AMPM' * 16 starts = '--M-' * 16 equal_gcs = [ GeneticCode(amino_acids, starts), # name should be ignored GeneticCode(amino_acids, starts, 'foo'), # metadata/positional metadata should be ignored if Sequence # subclass is provided GeneticCode( Protein(amino_acids, metadata={'foo': 'bar'}), Protein(starts, positional_metadata={'foo': range(64)})) ] # every gc should be equal to itself for gc in equal_gcs: self.assertTrue(gc == gc) self.assertFalse(gc != gc) # every pair of gcs should be equal. use permutations instead of # combinations to test that comparing gc1 to gc2 and gc2 to gc1 are # both equal for gc1, gc2 in itertools.permutations(equal_gcs, 2): self.assertTrue(gc1 == gc2) self.assertFalse(gc1 != gc2)
def test_translate_varied_genetic_codes(self): # spot check using a few NCBI and custom genetic codes to translate seq = RNA('AAUGAUGUGACUAUCAGAAGG') # table_id=2 exp = Protein('NDVTI**') obs = GeneticCode.from_ncbi(2).translate(seq) self.assertEqual(obs, exp) exp = Protein('MTI') obs = GeneticCode.from_ncbi(2).translate(seq, start='require', stop='require') self.assertEqual(obs, exp) # table_id=22 exp = Protein('NDVTIRR') obs = GeneticCode.from_ncbi(22).translate(seq) self.assertEqual(obs, exp) with six.assertRaisesRegex(self, ValueError, 'reading_frame=1.*start=\'require\''): GeneticCode.from_ncbi(22).translate(seq, start='require', stop='require') # custom, no start codons gc = GeneticCode('MWN*' * 16, '-' * 64) exp = Protein('MM*MWN*') obs = gc.translate(seq) self.assertEqual(obs, exp) with six.assertRaisesRegex(self, ValueError, 'reading_frame=1.*start=\'require\''): gc.translate(seq, start='require', stop='require')
def test_from_ncbi_valid_table_ids(self): # spot check a few tables self.assertEqual(GeneticCode.from_ncbi().name, 'Standard') self.assertEqual( GeneticCode.from_ncbi(2).name, 'Vertebrate Mitochondrial') self.assertEqual( GeneticCode.from_ncbi(12).name, 'Alternative Yeast Nuclear') self.assertEqual( GeneticCode.from_ncbi(25).name, 'Candidate Division SR1 and Gracilibacteria')
def test_from_ncbi_valid_table_ids(self): # spot check a few tables self.assertEqual(GeneticCode.from_ncbi().name, 'Standard') self.assertEqual(GeneticCode.from_ncbi(2).name, 'Vertebrate Mitochondrial') self.assertEqual(GeneticCode.from_ncbi(12).name, 'Alternative Yeast Nuclear') self.assertEqual(GeneticCode.from_ncbi(25).name, 'Candidate Division SR1 and Gracilibacteria')
def test_translate_varied_genetic_codes(self): # spot check using a few NCBI and custom genetic codes to translate seq = RNA('AAUGAUGUGACUAUCAGAAGG') # table_id=2 exp = Protein('NDVTI**') obs = GeneticCode.from_ncbi(2).translate(seq) self.assertEqual(obs, exp) exp = Protein('MTI') obs = GeneticCode.from_ncbi(2).translate(seq, start='require', stop='require') self.assertEqual(obs, exp) # table_id=22 exp = Protein('NDVTIRR') obs = GeneticCode.from_ncbi(22).translate(seq) self.assertEqual(obs, exp) with self.assertRaisesRegex(ValueError, 'reading_frame=1.*start=\'require\''): GeneticCode.from_ncbi(22).translate(seq, start='require', stop='require') # custom, no start codons gc = GeneticCode('MWN*' * 16, '-' * 64) exp = Protein('MM*MWN*') obs = gc.translate(seq) self.assertEqual(obs, exp) with self.assertRaisesRegex(ValueError, 'reading_frame=1.*start=\'require\''): gc.translate(seq, start='require', stop='require')
def test_init_varied_equivalent_input(self): for args in (('M' * 64, '-' * 64), (Protein('M' * 64), Protein('-' * 64)), (Sequence('M' * 64), Sequence('-' * 64))): gc = GeneticCode(*args) self.assertEqual(gc.name, '') self.assertEqual(gc._amino_acids, Protein('M' * 64)) self.assertEqual(gc._starts, Protein('-' * 64)) npt.assert_array_equal(gc._m_character_codon, np.asarray([0, 0, 0], dtype=np.uint8)) self.assertEqual(len(gc._start_codons), 0)
def test_translate_six_frames_genetic_code_object(self): gc = GeneticCode('M' * 64, '-' * 64) for seq in RNA('AAAUUG'), DNA('AAATTG'): obs = list(seq.translate_six_frames(gc)) self.assertEqual(obs, [ Protein('MM'), Protein('M'), Protein('M'), Protein('MM'), Protein('M'), Protein('M') ])
def test_init_invalid_input(self): # `amino_acids` invalid protein with six.assertRaisesRegex(self, ValueError, 'Invalid character.*J'): GeneticCode('J' * 64, '-' * 64) # wrong number of amino acids with six.assertRaisesRegex(self, ValueError, 'amino_acids.*64.*42'): GeneticCode('M' * 42, '-' * 64) # `amino_acids` missing M with six.assertRaisesRegex(self, ValueError, 'amino_acids.*M.*character'): GeneticCode('A' * 64, '-' * 64) # `starts` invalid protein with six.assertRaisesRegex(self, ValueError, 'Invalid character.*J'): GeneticCode('M' * 64, 'J' * 64) # wrong number of starts with six.assertRaisesRegex(self, ValueError, 'starts.*64.*42'): GeneticCode('M' * 64, '-' * 42) # invalid characters in `starts` with six.assertRaisesRegex(self, ValueError, 'starts.*M and - characters'): GeneticCode('M' * 64, '-M' * 30 + '*AQR')
def test_str(self): # predefined exp = ( ' AAs = FFLLSSSSYY**CC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAA' 'DDEEGGGG\n' 'Starts = ---M---------------M---------------M--------------------' '--------\n' 'Base1 = UUUUUUUUUUUUUUUUCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGG' 'GGGGGGGG\n' 'Base2 = UUUUCCCCAAAAGGGGUUUUCCCCAAAAGGGGUUUUCCCCAAAAGGGGUUUUCCCC' 'AAAAGGGG\n' 'Base3 = UCAGUCAGUCAGUCAGUCAGUCAGUCAGUCAGUCAGUCAGUCAGUCAGUCAGUCAG' 'UCAGUCAG') self.assertEqual(str(self.sgc), exp) # custom, no name obs = str(GeneticCode('M' * 64, '-' * 64)) self.assertIn('M' * 64, obs) self.assertIn('-' * 64, obs)
def test_ne(self): class GeneticCodeSubclass(GeneticCode): pass amino_acids = 'AMPM' * 16 starts = '--M-' * 16 unequal_gcs = [ GeneticCode(amino_acids, starts), # type must match GeneticCodeSubclass(amino_acids, starts), # completely different type 'foo' ] # none of the NCBI genetic codes should be equal to each other unequal_gcs.extend(_ncbi_genetic_codes.values()) for gc in unequal_gcs: self.assertTrue(gc == gc) self.assertFalse(gc != gc) for gc1, gc2 in itertools.permutations(unequal_gcs, 2): self.assertTrue(gc1 != gc2) self.assertFalse(gc1 == gc2)
def test_from_ncbi_invalid_input(self): with six.assertRaisesRegex(self, ValueError, 'table_id.*7'): GeneticCode.from_ncbi(7) with six.assertRaisesRegex(self, ValueError, 'table_id.*42'): GeneticCode.from_ncbi(42)
def setUp(self): self.sgc = GeneticCode.from_ncbi(1)
def test_translate_genetic_code_object(self): gc = GeneticCode('M' * 64, '-' * 64) for seq in RNA('AAAUUUAUGCAU'), DNA('AAATTTATGCAT'): obs = seq.translate(gc) self.assertEqual(obs, Protein('MMMM'))
def test_from_ncbi_invalid_input(self): with self.assertRaisesRegex(ValueError, 'table_id.*7'): GeneticCode.from_ncbi(7) with self.assertRaisesRegex(ValueError, 'table_id.*42'): GeneticCode.from_ncbi(42)
def setUp(self): self.sgc = GeneticCode.from_ncbi(1)